mpidb The Microbial Protein Interaction Database The YjbH protein of Bacillus subtilis enhances ClpXP-catalyzed proteolysis of Spx. The YjbH protein of Bacillus subtilis enhances ClpXP-catalyzed proteolysis of Spx. J. Bacteriol. (0021-9193) 2009 imex curation Garg S.K., Kommineni S., Henslee L., Zhang Y., Zuber P. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Garg S.K., Kommineni S., Henslee L., Zhang Y., Zuber P. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation The YjbH protein of Bacillus subtilis enhances ClpXP-catalyzed proteolysis of Spx. The YjbH protein of Bacillus subtilis enhances ClpXP-catalyzed proteolysis of Spx. J. Bacteriol. (0021-9193) 2009 imex curation Garg S.K., Kommineni S., Henslee L., Zhang Y., Zuber P. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Garg S.K., Kommineni S., Henslee L., Zhang Y., Zuber P. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation spxh_bacsu ClpXP adapter protein SpxH spxH yjbH BSU11550 protein protein bacsu Bacillus subtilis MTNYQHELYFAHCHGHPKKPLEIYMFVDPLCPECWSLEPVIKKLKIRYGRFFTLRIIASASLTALNKKRKKHLLAEAWEKIASRSGMSCDGNVWFEQDQPLSSPYMAALAFKAAELQGRKAGMQFLRNMQESLFVSKKNITDENVLLEIAENTSLDLEEFKKDLHSQSAVKALQCDMKIAAEMDVSVNPTLTFFNTQHEDEGLKVPGSYSYDVYEEILFEMLGDEPKPSETPPLECFIEYFRFVASKEIALVYDLSLEEVEKEMKKLAFAKKVAKVEAKHGMFWKSLSTYSDEYQSCEK A2F4BD24A1977339 spx_bacsu Global transcriptional regulator Spx spx Redox-responsive transcription factor Spx Suppressor of clpP and clpX spxA yjbD BSU11500 protein protein bacsu Bacillus subtilis MVTLYTSPSCTSCRKARAWLEEHEIPFVERNIFSEPLSIDEIKQILRMTEDGTDEIISTRSKVFQKLNVNVESMPLQDLYRLINEHPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRKVRSFQLREAQRLAN E296B3B7A90397D7 spxa-yjbh 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey o31606-1-24 O31606-1-24 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1A spxa-yjbh-1 2 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Thiol oxidant diamide. Figs. 1C, 1D