mpidb The Microbial Protein Interaction Database The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. Mol. Microbiol. (0950-382X) 2009 imex curation Cunningham K.A., Burkholder W.F. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Cunningham K.A., Burkholder W.F. Accepted 2013-FEB-06 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. Mol. Microbiol. (0950-382X) 2009 imex curation Cunningham K.A., Burkholder W.F. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay tag visualisation tag visualisation Cunningham K.A., Burkholder W.F. C-terminal tag is radio-labelled via a PKA-dependent phosphorylation assay. Accepted 2013-FEB-06 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. Mol. Microbiol. (0950-382X) 2009 imex curation Cunningham K.A., Burkholder W.F. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Cunningham K.A., Burkholder W.F. C-terminal tag is radio-labelled via a PKA-dependent phosphorylation assay. Accepted 2013-FEB-06 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. Mol. Microbiol. (0950-382X) 2009 imex curation Cunningham K.A., Burkholder W.F. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Cunningham K.A., Burkholder W.F. Accepted 2013-FEB-06 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. Mol. Microbiol. (0950-382X) 2009 imex curation Cunningham K.A., Burkholder W.F. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Cunningham K.A., Burkholder W.F. Accepted 2013-FEB-06 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. The histidine kinase inhibitor Sda binds near the site of autophosphorylation and may sterically hinder autophosphorylation and phosphotransfer to Spo0F. Mol. Microbiol. (0950-382X) 2009 imex curation Cunningham K.A., Burkholder W.F. Only protein-protein interactions in vitro In vitro phosphotransferase phosphotransferase assay phosphotransferase weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Cunningham K.A., Burkholder W.F. C-terminal tag is radio-labelled via a PKA-dependent phosphorylation assay. Accepted 2013-FEB-06 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation sda_bacsu Sporulation inhibitor sda sda Histidine kinase KinA inhibitor BSU25690 protein protein bacsu Bacillus subtilis MNWVPSMRKLSDELLIESYFKATEMNLNRDFIELIENEIKRRSLGHIISVSS BCBDECF0E0203CAE kina_bacsu Sporulation kinase A kinA Stage II sporulation protein F Stage II sporulation protein J gsiC scoD spoIIF spoIIJ BSU13990 protein protein bacsu Bacillus subtilis MEQDTQHVKPLQTKTDIHAVLASNGRIIYISANSKLHLGYLQGEMIGSFLKTFLHEEDQFLVESYFYNEHHLMPCTFRFIKKDHTIVWVEAAVEIVTTRAERTEREIILKMKVLEEETGHQSLNCEKHEIEPASPESTTYITDDYERLVENLPSPLCISVKGKIVYVNSAMLSMLGAKSKDAIIGKSSYEFIEEEYHDIVKNRIIRMQKGMEVGMIEQTWKRLDGTPVHLEVKASPTVYKNQQAELLLLIDISSRKKFQTILQKSRERYQLLIQNSIDTIAVIHNGKWVFMNESGISLFEAATYEDLIGKNIYDQLHPCDHEDVKERIQNIAEQKTESEIVKQSWFTFQNRVIYTEMVCIPTTFFGEAAVQVILRDISERKQTEELMLKSEKLSIAGQLAAGIAHEIRNPLTAIKGFLQLMKPTMEGNEHYFDIVFSELSRIELILSELLMLAKPQQNAVKEYLNLKKLIGEVSALLETQANLNGIFIRTSYEKDSIYINGDQNQLKQVFINLIKNAVESMPDGGTVDIIITEDEHSVHVTVKDEGEGIPEKVLNRIGEPFLTTKEKGTGLGLMVTFNIIENHQGVIHVDSHPEKGTAFKISFPKK A8BB97FE844B32EE A8BB97FE844B32EE sp0f_bacsu Sporulation initiation phosphotransferase F spo0F Stage 0 sporulation protein F BSU37130 protein protein bacsu Bacillus subtilis MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN 4130377E3558D698 4130377E3558D698 kina-kina-3 1 8 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 8 enzyme target enzyme target substrate substrate unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 7 inhibitor inhibitor unspecified role unspecified role physical association physical association Fig. 1, 2B Higher concentrations of Sda are required to inhibit the autophosphorylation activities of KinA(P410L) and KinA(P410L/F436S) than to inhibit wild-type KinA kina-kina-4 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation Fig. 1 kina-sda 5 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait P16497:p.[Pro410Leu;Phe436Ser] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P L certain certain sequence position certain certain certain sequence position certain F S Wed May 02 15:46:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro410leu,phe436ser' Tue Jun 30 16:09:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro410Leu;Phe436Ser]' P16497:p.Pro410Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P L Wed May 02 18:59:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro410leu' Tue Jun 30 17:50:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro410Leu' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction Fig. 2A kina-sda-1 3 8 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal rrasv tag tag tag insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain P16497:p.Tyr431Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 17:58:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr431cys' Tue Jun 30 18:25:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr431Cys' ecolx Escherichia coli 7 unspecified role unspecified role prey prey direct interaction direct interaction Fig. 4, 9 Sda Ser12Cys substitution restored the interaction of Sda with KinA(Tyr431Cys) kina-sda-3 4 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component P16497:p.Tyr431Cys mutation mutation certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 16:15:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr431cys' Tue Jun 30 17:25:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr431Cys' n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P16497:p.Ala413Cys mutation mutation certain certain sequence position certain certain certain sequence position certain A C Wed May 02 19:48:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala413cys' Tue Jun 30 20:16:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala413Cys' ecolx Escherichia coli direct interaction direct interaction Fig. 4 kina 2 8 putative self putative self putative self putative self n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal rrasv tag tag tag insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true Fig. 8 kina-sda-4 2 8 putative self putative self putative self putative self n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal rrasv tag tag tag insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 inhibitor inhibitor unspecified role unspecified role direct interaction direct interaction Fig. 8 kina-spo0f 6 9 phosphate acceptor phosphate acceptor unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 8 photon donor photon donor photon donor unspecified role unspecified role region 32p radiolabel 32p radiolabel P32 32P 32P P32 insertion analysis insertion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli phosphotransfer phosphotransfer reaction phosphotransfer Fig. 10 kina-sda-5 6 7 inhibitor inhibitor unspecified role unspecified role ecolx Escherichia coli 9 phosphate acceptor phosphate acceptor unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 8 photon donor photon donor photon donor unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 32p radiolabel 32p radiolabel P32 32P 32P P32 insertion analysis insertion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig. 10