mpidb The Microbial Protein Interaction Database A single aromatic residue in transcriptional repressor protein KorA is critical for cooperativity with its co-regulator KorB. A single aromatic residue in transcriptional repressor protein KorA is critical for cooperativity with its co-regulator KorB. Mol. Microbiol. (0950-382X) 2008 imex curation Bingle L.E., Rajasekar K.V., Muntaha S., Nadella V., Hyde E.I., Thomas C.M. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Bingle L.E., Rajasekar K.V., Muntaha S., Nadella V., Hyde E.I., Thomas C.M. Accepted 2013-FEB-01 by ORCHARD Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation A single aromatic residue in transcriptional repressor protein KorA is critical for cooperativity with its co-regulator KorB. A single aromatic residue in transcriptional repressor protein KorA is critical for cooperativity with its co-regulator KorB. Mol. Microbiol. (0950-382X) 2008 imex curation Bingle L.E., Rajasekar K.V., Muntaha S., Nadella V., Hyde E.I., Thomas C.M. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Bingle L.E., Rajasekar K.V., Muntaha S., Nadella V., Hyde E.I., Thomas C.M. Accepted 2013-FEB-01 by ORCHARD Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation kora2_ecolx TrfB transcriptional repressor protein Regulatory protein KorA korA trfB protein protein ecolx Escherichia coli MKKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKKQETKR 25622FB8F98F21A5 korb2_ecolx Transcriptional repressor protein KorB korB protein protein ecolx Escherichia coli MTAAQAKTTKKNTAAAAQEAAGAAQPSGLGLDSIGDLSSLLDAPAASQGGSGPIELDLDLIDEDPHQPRTADNPGFSPESIAEIGATIKERGVKSPISVRENQEQPGRYIINHGARRYRGSKWAGKKSIPAFIDNDYNEADQVIENLQRNELTPREIADFIGRELAKGKKKGDIAKEIGKSPAFITQHVTLLDLPEKIADAFNTGRVRDVTVVNELVTAFKKRPEEVEAWLDDDTQEITRGTVKLLREFLDEKGRDPNTVDAFNGQTDAERDAEAGDGQDGEDGDQDGKDAKEKGAKEPDPDKLKKAIVQVEHDERPARLILNRRPPAEGYAWLKYEDDGQEFEANLADVKLVALIEG 52F49477363F2279 korb-trfb 2 3 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Fig. 2 korb-trfb-2 1 4 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 3 unspecified role unspecified role prey prey P03052:p.Gln82Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 14:43:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln82ala' Tue Jun 30 16:22:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln82Ala' P03052:p.Val74Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V A Wed May 02 17:44:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val74ala' Tue Jun 30 17:15:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val74Ala' P03052:p.Tyr84Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 14:55:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr84ala' Tue Jun 30 16:58:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr84Ala' P03052:p.Pro68Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:15:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro68ala' Tue Jun 30 17:33:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro68Ala' P03052:p.Leu78Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:44:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu78ala' Tue Jun 30 15:35:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu78Ala' ecolx Escherichia coli physical association physical association Fig. 4