mpidb The Microbial Protein Interaction Database The carboxyl-terminal domain of TraR, a Streptomyces HutC family repressor, functions in oligomerization. The carboxyl-terminal domain of TraR, a Streptomyces HutC family repressor, functions in oligomerization. J. Bacteriol. (0021-9193) 2008 imex curation Kataoka M., Tanaka T., Kohno T., Kajiyama Y. mars@shinshu-u.ac.jp 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kataoka M., Tanaka T., Kohno T., Kajiyama Y. mars@shinshu-u.ac.jp Accepted 2013-JAN-28 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation The carboxyl-terminal domain of TraR, a Streptomyces HutC family repressor, functions in oligomerization. The carboxyl-terminal domain of TraR, a Streptomyces HutC family repressor, functions in oligomerization. J. Bacteriol. (0021-9193) 2008 imex curation Kataoka M., Tanaka T., Kohno T., Kajiyama Y. mars@shinshu-u.ac.jp 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kataoka M., Tanaka T., Kohno T., Kajiyama Y. mars@shinshu-u.ac.jp Accepted 2013-JAN-28 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation g0kud5_9actn traR protein protein 9acto Streptomyces flavovirens MPYKAPEGKGYADVATHFRTLIKSGELAPGDTLPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGALGTVVEKNPIVITGADRLKRMEKNGMRYAPGETSSGHRVMTRSVHDPEICTALTLEPGDEAVIRIRVFRQDDKPTSVGVSVYPPHTVAAVPELGEDVRMVKQFDKLYSERTGREVVKGQRAAHARQASQDELNALRSTPPAHSAIAVMVTTVTFHDDEQALGYWEDVYAPGARVPMGE FDA51F86968DA74A g0kud5-g0kud5-1 2 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 8 physical association physical association Figs. 5, 6 g0kud5-g0kud5 1 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 14 11 physical association physical association Fig. 4 g0kud5-g0kud5-2 2 3 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 5