mpidb The Microbial Protein Interaction Database Artificial septal targeting of Bacillus subtilis cell division proteins in Escherichia coli: an interspecies approach to the study of protein-protein interactions in multiprotein complexes. Artificial septal targeting of Bacillus subtilis cell division proteins in Escherichia coli: an interspecies approach to the study of protein-protein interactions in multiprotein complexes. J. Bacteriol. (0021-9193) 2008 imex curation Robichon C., King G.F., Goehring N.W., Beckwith J. E. coli artificial septal targeting systemused for examining the interactions by fusing of one of the proteins (the “bait”) to ZapA, an E. coli protein targeted to mid-cell, and the second potentially interacting partner (the “prey”) to green fluorescent protein (GFP). A positive interaction between two test proteins in E. coli leads to septal localization of the GFP fusion construct, which can be detected by fluorescence microscopy. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Robichon C., King G.F., Goehring N.W., Beckwith J. E. coli artificial septal targeting systemused for examining the interactions by fusing of one of the proteins (the “bait”) to ZapA, an E. coli protein targeted to mid-cell, and the second potentially interacting partner (the “prey”) to green fluorescent protein (GFP). A positive interaction between two test proteins in E. coli leads to septal localization of the GFP fusion construct, which can be detected by fluorescence microscopy. Accepted 2013-JAN-18 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation ftsl_bacsu Cell division protein FtsL yllD ylxB BSU15150 ftsL protein protein bacsu Bacillus subtilis MSNLAYQPEKQQRHAISPEKKVIVKKRASITLGEKVLLVLFAAAVLSVSLLIVSKAYAAYQTNIEVQKLEEQISSENKQIGDLEKSVADLSKPQRIMDIAKKNGLNLKDKKVKNIQE 8198D434E6F788FE divic_bacsu Cell division protein DivIC divA BSU00620 divIC protein protein bacsu Bacillus subtilis MNFSRERTITEIQNDYKEQVERQNQLKKRRRKGLYRRLTVFGALVFLTAIVLASSVWSQTSSLSAKEEKKEQLEKELKSLKTKQTDLKEEISKLKDEDYVTELARRDLFMSGDGEIIFNVEKKSK 2ABEB34268BB5DC0 pbp2b_bacsu Penicillin-binding protein 2B Penicillin-binding protein B pbpB Penicillin-sensitive peptidoglycan D,D-transpeptidase BSU15160 protein protein bacsu Bacillus subtilis MPKKNKFMNRGAAILSICFALFFFVILGRMAYIQITGKANGEVLATKATEQHEKKRTIEASRGSILDRKGKVIAEDTATYKLIAILDKKMTTDVKHPQHVVNKEKTAEALSKVINLDKADILDILNKDAKQVEFGSAGRDITYSQKQKIEKMKLPGISFLRDTKRYYPNGVFASNLIGYAEVDEETNEISGAMGLEKVLDKYLKERDGYVTYESDKSGWELPNSKNKITAPKNGDNVYLTIDQKIQTFLEDSMTKVAQKYNPKKIMAAVVDPKTGKVLAMGQRPSFDPNKRDVTNYYNDLISYAYEPGSTMKIFTLAAAMQENVFNANEKYKSGTFEVGGAPVKDHNNGVGWGPTTYHDGVLRSSNVAFAKLAKEKLGYDRLNQYLHKFNFYQKTGIDLPGEVSSKINFKYEFDKASTAYGQASAVTPIQQIQAATAIANDGKMMKPYVIDHIVDPDKDKTIYQNKPESAGTPISASTAKKVRDILGEVVTSKIGTGQAYKIEGFDVAGKTGTAQIAGKGGYLDGTDNYIFSFMGMAPKDDPELLIYVAVQQPQLKAGQSSSDPVSEIFNPTMKNSLHYLNIEPTEKSDSDKEETKAQTMPDLTDQTVAAAQKKAKEENLTPIVIGSDVAVKEQYPKADEEVLTNQKVFLKTGGKIKMPDMTGWSRREVLQYGELAGIHIEVSGQGYAVSQSVKKDKEIKDKTVIKVKFKNPD B173ABEF5F1C944C divib_bacsu Cell division protein DivIB dds Cell division and sporulation protein BSU15240 divIB Division initiation protein DivIB protein protein bacsu Bacillus subtilis MNPGQDREKIVNIEERIPKIKEQRKQKANRRLISFIMLFFIMVLIIVYLQTPISKVSTISVTGNENVSKKEIIDLSDINSGDTEFWSLDKQKTEKKIQQNKLVKKAEISKSLPNKINIAIEEYKAIAYLEKDDVYYEVLENGSVLPNEVTPDDAGPILVNWTNAKKRSQMAKQLDALSNSLKQSISEIYYTPVKMDENRIKLYMNDGYVVTASIKTFADRMKTYPSIISQLSSNKKGIIHLEVATYFEEFGKNDKAAKKEDEN 7CBEC797F4352864 divib-pbpb-4 1 4 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal zapa fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig. 3L divic-ftsl-2 1 2 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal zapa fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig. 3 ftsl-divic-1 1 3 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role bait bait n-terminal zapa fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 3