UniProt UniProt http://www.uniprot.org Membrane glycoprotein M6B interacts with the human serotonin transporter. Membrane glycoprotein M6B interacts with the human serotonin transporter. J. Mol. Neurosci. (0895-8696) 2009 imex curation Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk 20-Jun-2012: Contacted by JYOTI. human brain cDNA Only protein-protein interactions rat-rn46a Rattus norvegicus RN46A cell line rn46a RN46A temperature-sensitive neuronal cell line derived from E13 rat raphe nucleus confocal microscopy confocal microscopy immunostaining immunostaining Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk Accepted 2012-MAY-23 by PPORRAS 20-Jun-2012: Contacted by JYOTI. human brain cDNA J. Mol. Neurosci. (0895-8696) 2009 Only protein-protein interactions imex curation Membrane glycoprotein M6B interacts with the human serotonin transporter. Membrane glycoprotein M6B interacts with the human serotonin transporter. J. Mol. Neurosci. (0895-8696) 2009 imex curation Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk 20-Jun-2012: Contacted by JYOTI. human brain cDNA Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk Accepted 2012-MAY-23 by PPORRAS 20-Jun-2012: Contacted by JYOTI. human brain cDNA J. Mol. Neurosci. (0895-8696) 2009 Only protein-protein interactions imex curation Membrane glycoprotein M6B interacts with the human serotonin transporter. Membrane glycoprotein M6B interacts with the human serotonin transporter. J. Mol. Neurosci. (0895-8696) 2009 imex curation Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk 20-Jun-2012: Contacted by JYOTI. human brain cDNA Only protein-protein interactions human-msr-293 Homo sapiens msr-293 HEK-MSR-293 cell line expressing the human macrophage scavenger receptor confocal microscopy confocal microscopy immunostaining immunostaining Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk Accepted 2012-MAY-23 by PPORRAS 20-Jun-2012: Contacted by JYOTI. human brain cDNA J. Mol. Neurosci. (0895-8696) 2009 Only protein-protein interactions imex curation Membrane glycoprotein M6B interacts with the human serotonin transporter. Membrane glycoprotein M6B interacts with the human serotonin transporter. J. Mol. Neurosci. (0895-8696) 2009 imex curation Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk 20-Jun-2012: Contacted by JYOTI. human brain cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk Accepted 2012-MAY-23 by PPORRAS human brain cDNA J. Mol. Neurosci. (0895-8696) 2009 Only protein-protein interactions imex curation Membrane glycoprotein M6B interacts with the human serotonin transporter. Membrane glycoprotein M6B interacts with the human serotonin transporter. J. Mol. Neurosci. (0895-8696) 2009 imex curation Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk 20-Jun-2012: Contacted by JYOTI. human brain cDNA Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk Accepted 2012-MAY-23 by PPORRAS 20-Jun-2012: Contacted by JYOTI. human brain cDNA J. Mol. Neurosci. (0895-8696) 2009 Only protein-protein interactions imex curation sc6a4_human Sodium-dependent serotonin transporter SLC6A4 HTT SERT 5HT transporter Solute carrier family 6 member 4 protein protein human Homo sapiens Human METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV 0EB535B0A579BDA2 sc6a4_rat Sodium-dependent serotonin transporter Slc6a4 5HT transporter Solute carrier family 6 member 4 protein protein rat Rattus norvegicus (Rat) Rat METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEASHSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIIAWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIHQSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGATLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLTLTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLISTPGTLKERIIKSITPETPTEIPCGDIRMNAV 44DA7C5888C403EE gpm6b_human Neuronal membrane glycoprotein M6-b GPM6B M6B protein protein human Homo sapiens Human MKPAMETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALAGTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELHGEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALLIYMMATTYNYAVLKFKSREDCCTKF 560AB12DD2B5AE75 gpm6b_mouse Neuronal membrane glycoprotein M6-b Gpm6b M6b protein protein mouse Mus musculus Mouse MKPAMETAAEENTEQSQERKVNSRAEMEIGRYHWMYPGSKNHQYRPVPNLGDRAGPLSSPGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALAGTVAILEQHFSTNTSDHALLSEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELHGEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQSNGTSGVEQICVDVRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALIHFLMILSSNWAYLKDASKMQAYQDIKAKEEQELQDIQSRSKEQLNSYT 88BE3C67DF024B33 gpm6b_rat Neuronal membrane glycoprotein M6-b Gpm6b rhombex-29 M6b Rhombencephalic expression protein-29 kDa protein protein rat Rattus norvegicus (Rat) Rat MKPAMETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALAGTVAILEQHFSTNTSDHALLSEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELHGEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQSNGTSGVEQICVDVRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALLIYMMATTYNYAVLKFKSREDCCPKF 81BA7690D70C1333 slc6a4-gpm6b 4 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association no figure slc6a4-gpm6b-2 2 9 unspecified role unspecified role prey prey cell lysate cell lysate region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-msr-293 Homo sapiens msr-293 HEK-MSR-293 cell line expressing the human macrophage scavenger receptor 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 1b slc6a4-gpm6b-1 5 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1c gpm6b-slc6a4 1 7 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component association association 6D gpm6b-slc6a4-1 3 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection 9 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 6a