UniProt UniProt http://www.uniprot.org Kank regulates RhoA-dependent formation of actin stress fibers and cell migration via 14-3-3 in PI3K-Akt signaling. Kank regulates RhoA-dependent formation of actin stress fibers and cell migration via 14-3-3 in PI3K-Akt signaling. J. Cell Biol. (0021-9525) 2008 imex curation Kakinuma N., Roy B.C., Zhu Y., Wang Y., Kiyama R. In vitro phosphorylation assay (fig 2D) not included as participants cannot be identified from the information provided in the publication. CoIP and pull down experiments fig S4 using GST-IRSp53 omitted as its origin cannot be established from the publication. kiyama.r@aist.go.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kakinuma N., Roy B.C., Zhu Y., Wang Y., Kiyama R. In vitro phosphorylation assay (fig 2D) not included as participants cannot be identified from the information provided in the publication. CoIP and pull down experiments fig S4 using GST-IRSp53 omitted as its origin cannot be established from the publication. kiyama.r@aist.go.jp Accepted 2012-JUL-17 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2008 Only protein-protein interactions imex curation Kank regulates RhoA-dependent formation of actin stress fibers and cell migration via 14-3-3 in PI3K-Akt signaling. Kank regulates RhoA-dependent formation of actin stress fibers and cell migration via 14-3-3 in PI3K-Akt signaling. J. Cell Biol. (0021-9525) 2008 imex curation Kakinuma N., Roy B.C., Zhu Y., Wang Y., Kiyama R. In vitro phosphorylation assay (fig 2D) not included as participants cannot be identified from the information provided in the publication. CoIP and pull down experiments fig S4 using GST-IRSp53 omitted as its origin cannot be established from the publication. kiyama.r@aist.go.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kakinuma N., Roy B.C., Zhu Y., Wang Y., Kiyama R. In vitro phosphorylation assay (fig 2D) not included as participants cannot be identified from the information provided in the publication. CoIP and pull down experiments fig S4 using GST-IRSp53 omitted as its origin cannot be established from the publication. kiyama.r@aist.go.jp Accepted 2012-JUL-17 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2008 Only protein-protein interactions imex curation Kank regulates RhoA-dependent formation of actin stress fibers and cell migration via 14-3-3 in PI3K-Akt signaling. Kank regulates RhoA-dependent formation of actin stress fibers and cell migration via 14-3-3 in PI3K-Akt signaling. J. Cell Biol. (0021-9525) 2008 imex curation Kakinuma N., Roy B.C., Zhu Y., Wang Y., Kiyama R. In vitro phosphorylation assay (fig 2D) not included as participants cannot be identified from the information provided in the publication. CoIP and pull down experiments fig S4 using GST-IRSp53 omitted as its origin cannot be established from the publication. kiyama.r@aist.go.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-vmrc-rcw Homo sapiens renal cell carcinoma cell line VMRC-RCW vmrc-rcw human renal cell carcinoma cell line VMRC-RCW anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kakinuma N., Roy B.C., Zhu Y., Wang Y., Kiyama R. In vitro phosphorylation assay (fig 2D) not included as participants cannot be identified from the information provided in the publication. CoIP and pull down experiments fig S4 using GST-IRSp53 omitted as its origin cannot be established from the publication. kiyama.r@aist.go.jp Accepted 2012-JUL-17 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2008 Only protein-protein interactions imex curation Kank regulates RhoA-dependent formation of actin stress fibers and cell migration via 14-3-3 in PI3K-Akt signaling. Kank regulates RhoA-dependent formation of actin stress fibers and cell migration via 14-3-3 in PI3K-Akt signaling. J. Cell Biol. (0021-9525) 2008 imex curation Kakinuma N., Roy B.C., Zhu Y., Wang Y., Kiyama R. In vitro phosphorylation assay (fig 2D) not included as participants cannot be identified from the information provided in the publication. CoIP and pull down experiments fig S4 using GST-IRSp53 omitted as its origin cannot be established from the publication. kiyama.r@aist.go.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions blepharandra heteropetala Blepharandra heteropetala pull down pull down predetermined predetermined participant predetermined Kakinuma N., Roy B.C., Zhu Y., Wang Y., Kiyama R. In vitro phosphorylation assay (fig 2D) not included as participants cannot be identified from the information provided in the publication. CoIP and pull down experiments fig S4 using GST-IRSp53 omitted as its origin cannot be established from the publication. kiyama.r@aist.go.jp Accepted 2012-JUL-17 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2008 Only protein-protein interactions imex curation Kank regulates RhoA-dependent formation of actin stress fibers and cell migration via 14-3-3 in PI3K-Akt signaling. Kank regulates RhoA-dependent formation of actin stress fibers and cell migration via 14-3-3 in PI3K-Akt signaling. J. Cell Biol. (0021-9525) 2008 imex curation Kakinuma N., Roy B.C., Zhu Y., Wang Y., Kiyama R. In vitro phosphorylation assay (fig 2D) not included as participants cannot be identified from the information provided in the publication. CoIP and pull down experiments fig S4 using GST-IRSp53 omitted as its origin cannot be established from the publication. kiyama.r@aist.go.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-imcd3 Mouse inner medullary collecting duct (mIMCD3) cells imcd3 Immortalized inner medullary collecting duct cells immortalized cells from the inner medullary collecting duct cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kakinuma N., Roy B.C., Zhu Y., Wang Y., Kiyama R. In vitro phosphorylation assay (fig 2D) not included as participants cannot be identified from the information provided in the publication. CoIP and pull down experiments fig S4 using GST-IRSp53 omitted as its origin cannot be established from the publication. kiyama.r@aist.go.jp Accepted 2012-JUL-17 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2008 Only protein-protein interactions imex curation 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN DIP protein P27348 original sequence version: 164 DIP protein P27348 original sequence version: 173 175534325E9E37C4 e9q238_mouse Kank1 protein protein mouse Mus musculus Mouse MAYTTKVNGCAAEKADGVLNGDHNKEKKDPYFVETPYGFQLDLDFVKYVDDIQKGNTIKKLNIQKRRKPSVPCPEVRAIPGHQGVWTSTESLSSSNSDDSKQCPSFLLARSHVTSTPIPRPPAPLETSPTFAVSENRQLLPPPSPQLPRHNLHVTKTLMETRRRLEQERVTMQMAPGDFRRPRLASFGGMGSTSSLPSFVGSANHSSAIHQLQNGYQGNGDYNSYVPAAPTTSSMGSSVRHSPLSSGISTPVTNVSPMHLQHIREQMAIALKRLKELEEQVRTIPVLQVKISVLQEEKRQLASQLKSQRASSQNEACGVRKRSYSAGNASQLELLARARRGGGELYIDYEEEEMESVEQSTQRIQEFRQLTADMQALERKIQDSSCEVASELRENGQCPSRECKSVAVGSDENMNDVVVYHRDLRPCKDTAVGTVTETRNVGISVTEAMLGVITEADKEIELQQQTIEALKEKIYRLEVQLKETTHDREMTKLKQELQAAGSRKKVDKATMAQPLVFSKLVEALVPTRDQMVGSHVDTRESCVGTSVQTSSVGTSCHPDCKNQVVGSELPMNWWVVKERVAMHDQCVGRSVETCDRSVGVEVSVCETGSNTEASGSDLTLLKTNLNLKDVRSIGCGDCSVDVIVCFPKECTSRSMNTEAVGQEEAAVMAVPHTTDQHTSTNLERVDQCTNTEAATLVESCTNTLLSTMDKQTSTQTVEMRTVAIGEGRVRDINPSTKTRSVGVGTVLSGNSEFDRPCAVKTKESGVGQINIQDNYLVGLKMRTIACGPPQLTVGLMGSRRSVGVGNEPVGELPEESPQPRVASGMVTGLDHYIERVQRLLAEQQTLLAENYSELAEAFGEPHSQIGSLNSQLISTLSSINSVMKSASTEELRNSDFQKASLGKTTGNHLEYTCKCGGLRSGGLLNVQPSQPEVEAETAEGKHSRGHEQFPMQGSTLPPVNLTDDQIATGLYVCPNNENTLKSIMKKSDGNKDSNGAKKNLQFIGINGGYETTSSDESSSDGSSSSESDDECDTIGYPPEEEEEEEEKDHDTRGMAEGHHAVNIEGFKSARVEDEVQVPECEPEKEEIRERYELSEKMLSACNLLKYNIKDPKALASKDMRICLNTLQHDWFRVSSQKSAVPAMVGDYIAAFEAVSPDVLRYIINMADGNGNTALHYSVSHSNFQIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMQVVEELFSCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHLNFSKAQSPSTPRLGRKTSPGPTHRGSFD 8A2F580524D8A61D q14678-2 KN motif and ankyrin repeat domain-containing protein 1 Kank-S KANK1 ANKRD15 KANK KIAA0172 Ankyrin repeat domain-containing protein 15 Kidney ankyrin repeat-containing protein protein protein human Homo sapiens Human METRRRLEQERATMQMTPGEFRRPRLASFGGMGTTSSLPSFVGSGNHNPAKHQLQNGYQGNGDYGSYAPAAPTTSSMGSSIRHSPLSSGISTPVTNVSPMHLQHIREQMAIALKRLKELEEQVRTIPVLQVKISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKEKIYRLEVQLRETTHDREMTKLKQELQAAGSRKKVDKATMAQPLVFSKVVEAVVQTRDQMVGSHMDLVDTCVGTSVETNSVGISCQPECKNKVVGPELPMNWWIVKERVEMHDRCAGRSVEMCDKSVSVEVSVCETGSNTEESVNDLTLLKTNLNLKEVRSIGCGDCSVDVTVCSPKECASRGVNTEAVSQVEAAVMAVPRTADQDTSTDLEQVHQFTNTETATLIESCTNTCLSTLDKQTSTQTVETRTVAVGEGRVKDINSSTKTRSIGVGTLLSGHSGFDRPSAVKTKESGVGQININDNYLVGLKMRTIACGPPQLTVGLTASRRSVGVGDDPVGESLENPQPQAPLGMMTGLDHYIERIQKLLAEQQTLLAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQIAAGLYACTNNESTLKSIMKKKDGNKDSNGAKKNLQFVGINGGYETTSSDDSSSDESSSSESDDECDVIEYPLEEEEEEEDEDTRGMAEGHHAVNIEGLKSARVEDEMQVQECEPEKVEIRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMVGDYIAAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGSFD F7CB58D947CCCE4C 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 1433s_human 14-3-3 protein sigma Stratifin Epithelial cell marker protein 1 HME1 SFN protein protein human Homo sapiens Human MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS DIP protein P31947 original sequence version: 84 7F4B44E3AA59ECE6 kank1_human KN motif and ankyrin repeat domain-containing protein 1 ANKRD15 KANK KIAA0172 Ankyrin repeat domain-containing protein 15 Kidney ankyrin repeat-containing protein KANK1 protein protein human Homo sapiens Human MAHTTKVNGSASGKAGDILSGDQDKEQKDPYFVETPYGYQLDLDFLKYVDDIQKGNTIKRLNIQKRRKPSVPCPEPRTTSGQQGIWTSTESLSSSNSDDNKQCPNFLIARSQVTSTPISKPPPPLETSLPFLTIPENRQLPPPSPQLPKHNLHVTKTLMETRRRLEQERATMQMTPGEFRRPRLASFGGMGTTSSLPSFVGSGNHNPAKHQLQNGYQGNGDYGSYAPAAPTTSSMGSSIRHSPLSSGISTPVTNVSPMHLQHIREQMAIALKRLKELEEQVRTIPVLQVKISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKEKIYRLEVQLRETTHDREMTKLKQELQAAGSRKKVDKATMAQPLVFSKVVEAVVQTRDQMVGSHMDLVDTCVGTSVETNSVGISCQPECKNKVVGPELPMNWWIVKERVEMHDRCAGRSVEMCDKSVSVEVSVCETGSNTEESVNDLTLLKTNLNLKEVRSIGCGDCSVDVTVCSPKECASRGVNTEAVSQVEAAVMAVPRTADQDTSTDLEQVHQFTNTETATLIESCTNTCLSTLDKQTSTQTVETRTVAVGEGRVKDINSSTKTRSIGVGTLLSGHSGFDRPSAVKTKESGVGQININDNYLVGLKMRTIACGPPQLTVGLTASRRSVGVGDDPVGESLENPQPQAPLGMMTGLDHYIERIQKLLAEQQTLLAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQIAAGLYACTNNESTLKSIMKKKDGNKDSNGAKKNLQFVGINGGYETTSSDDSSSDESSSSESDDECDVIEYPLEEEEEEEDEDTRGMAEGHHAVNIEGLKSARVEDEMQVQECEPEKVEIRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMVGDYIAAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGSFD DIP protein Q14678 original sequence version: 100 0C3993143391363B 1433t_mouse 14-3-3 protein theta Ywhaq 14-3-3 protein tau protein protein mouse Mus musculus Mouse MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN E30471260E8B366E 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein Q04917 original sequence version: 166 DIP protein Q04917 original sequence version: 168 DIP protein Q04917 original sequence version: 175 D70FBC100C45D6E5 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 1433g_human 14-3-3 protein gamma YWHAG Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN DIP protein P61981 original sequence version: 126 DIP protein P61981 original sequence version: 135 B0D16C6DE1F4455D kank1-ywhaq 3 11 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 1A kank1-kank1 1 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Q14678-2:p.Ser167Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:55:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser167ala' Tue Jun 30 16:08:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser167Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C and 2B kank1-ywhag 1 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C kank1-ywhae 1 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C kank1-ywhah 1 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C ywhaq-kank1 2 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2E Phosphorylation of KANK1 enhances interaction. ywhag-kank1 2 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2E Phosphorylation of KANK1 enhances interaction. ywhae-kank1 2 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2E Phosphorylation of KANK1 enhances interaction. ywhah-kank1 2 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2E Phosphorylation of KANK1 enhances interaction. ywhaz-kank1-1 4 8 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14678-2:p.Ser167Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:41:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser167ala' Tue Jun 30 19:12:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser167Ala' rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 15 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 2C ywhae-kank1-1 4 8 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14678-2:p.Ser167Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:28:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser167ala' Tue Jun 30 20:15:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser167Ala' rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 2C ywhab-kank1-1 4 8 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14678-2:p.Ser167Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:45:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser167ala' Tue Jun 30 17:19:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser167Ala' rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 2C ywhaq-kank1-1 4 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q14678-2:p.Ser167Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:10:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser167ala' Tue Jun 30 18:24:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser167Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes direct interaction direct interaction 2C ywhah-kank1-1 4 8 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14678-2:p.Ser167Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:04:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser167ala' Tue Jun 30 17:31:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser167Ala' rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 2C sfn-kank1-1 4 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q14678-2:p.Ser167Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:24:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser167ala' Tue Jun 30 17:57:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser167Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes direct interaction direct interaction 2C ywhag-kank1-1 4 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q14678-2:p.Ser167Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:02:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser167ala' Tue Jun 30 17:46:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser167Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes direct interaction direct interaction 2C kank1-ywhaq-1 5 7 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 3 DMSO, LY294002, Wortmannin EGF, insulin