mpidb The Microbial Protein Interaction Database Novel coiled-coil cell division factor ZapB stimulates Z ring assembly and cell division. Novel coiled-coil cell division factor ZapB stimulates Z ring assembly and cell division. Mol. Microbiol. (0950-382X) 2008 imex curation Ebersbach G., Galli E., Møller-Jensen J., Löwe J., Gerdes K. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Ebersbach G., Galli E., Møller-Jensen J., Löwe J., Gerdes K. Accepted 2013-JAN-16 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation ftsa_ecoli Cell division protein FtsA ftsA divA b0094 JW0092 protein protein ecoli Escherichia coli (strain K12) MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF DIP protein P0ABH0 original sequence version: 67 C2475377A229B982 ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD DIP protein P0A9A6 original sequence version: 83 DIP protein P0A9A6 original sequence version: 82 DIP protein P0A9A6 original sequence version: 72 B3A53340367DBBA0 zapb_ecoli Cell division protein ZapB yiiU zapB b3928 JW3899 protein protein ecoli Escherichia coli (strain K12) MTMSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKEQQNGWQERLQALLGRMEEV DIP protein P0AF36 original sequence version: 36 B01DC1A433A1D01B ftsa-ftsa-5 1 2 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association Table 1 zapb-ftsa-2 1 4 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association zapb-zapb-2 1 4 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Table 1 ftsz-ftsz-11 1 3 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association Table 1 ftsa-ftsz 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Table 1 zapb-zapb-3 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Table 1 ftsz-ftsz-12 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Table 1 ftsz-ftsz-10 1 3 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Table 1 ftsa-zapb 1 4 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Table 1