mpidb The Microbial Protein Interaction Database Enterococcus faecalis PcfC, a spatially localized substrate receptor for type IV secretion of the pCF10 transfer intermediate. Enterococcus faecalis PcfC, a spatially localized substrate receptor for type IV secretion of the pCF10 transfer intermediate. J. Bacteriol. (0021-9193) 2008 imex curation Chen Y., Zhang X., Manias D., Yeo H.J., Dunny G.M., Christie P.J. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chen Y., Zhang X., Manias D., Yeo H.J., Dunny G.M., Christie P.J. Accepted 2013-JAN-16 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation Enterococcus faecalis PcfC, a spatially localized substrate receptor for type IV secretion of the pCF10 transfer intermediate. Enterococcus faecalis PcfC, a spatially localized substrate receptor for type IV secretion of the pCF10 transfer intermediate. J. Bacteriol. (0021-9193) 2008 imex curation Chen Y., Zhang X., Manias D., Yeo H.J., Dunny G.M., Christie P.J. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Chen Y., Zhang X., Manias D., Yeo H.J., Dunny G.M., Christie P.J. Accepted 2013-JAN-16 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation q7x5p3_entfl pcfG protein protein entfl Enterococcus faecalis Streptococcus faecalis MVYTKHFVIHTFDKLNNACSYIENAEKTEVTNDNPSEHLEHLFQYIVNDDKTYMKKLVSGHGIVDPTNPYEEFKLTKLQAAIQRKIGYTFDPKSERLLPPTLTELEKGNAVLAHHLIQSFSPEDDLTPEKIHEIGYNTVMELTGGKYEFVIATHVDKEHLHNHIIFSSTNLKTGKAFRWQKGTKRVFEQISDKIAAKEGAKIIEKSPKQTHTKYTKWQTESIYKQKIKSRLDFLLEQSSSINDFLEKAEALNLSADFSNKWTTYRLLDEPQIKNTRSRSLSKSDPTRYNYEKIIERLKENKNVLTVEECVKRYEEKNEQEKNNFDYQFTIEPWQLSHKTERGYYINIDYGYGNSGKLFVGGYKVDPLDNGNYNIYIKRNEYFYFMSDKDATKSKYLTGASLIKQLRLYNGQTPLKREPVMQTIDELVSAINFLAANEIEDTRQLKLLEEKLEVAFLEAEKTLETLDEKMLELHQLSNLLLENELQGDPELIQKKLKTLLPDATLAEFSYEDVRGEIEAIKTSQTLLESKLERTRNEINQLHEIQAVQEKEPEKQTDIKPKL 1FF37CCFEC4E608A q5g3n9_entfl pcfC protein protein entfl Enterococcus faecalis Streptococcus faecalis MQTYKKELKPYLYLGVFLFVIGFGIGNFFWLLPGTDYFSKTNYLFTKDILTYIEQTFYRFFITPSLLGFSVGVLGFLLGLLMYVRDNDRGIYRHGEEYGSARFATPAEMKKYEDPIPENNIIVSKHVKISLFNKRLPIKLQKNKNIAILGDSGAAKTLAFIKTNLMQRHASFITTDPDGGILPEIGLLLKKGKYKIKVLDLNTLSNSDTFNVFEYMHSELDVDRVLEAVTEATKEVEKTTGDDFWIKAEGLLVRSLIAYLWFDGRRNDYTPHLGMIADMLRHLKRKDKNVPSPVEEWFEELNEAIPDNYAYRQWTLFNNLYESETRASVLGIAAARYSVFDHEEVVNMIRTDTMDIDSWNEEKTAVFIAIPETNTSFNFIAALMFATVGEVLRNKSDQVRLGKRVLEEGKELLHVRFLIDEFANIGRIPHFEKMLTTFRKREMSFTIVLQSLNQLQTLYRNGWQNILNGCACLLYLGGDEEETTKYLSARAGKQTLSIRKHSMNKGNQGGGSENRDKYGRDLIDRSEVALIGGDECLVFISKEHVFKDKKFYAFQHDRADELATGPTDDKWYTWRRYMTDEEAILDKISATDIIDHGEITSELKEETHV 64BB35098E684741 q5g3n6_entfl pcfF DAI13_16755 protein protein entfl Enterococcus faecalis Streptococcus faecalis MENKQKLKRPIQRIVRLSEEENNLIKRKIEESFFPNFQNFALHLLIQGEIRHVDYSELNRLTTEIHKIGININQMARLANQFHEISSEDIKDLTDKVQSLNALVQSELNKLIKRKDQS 24629587CD69EB17 pcff-pcfc 1 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined entfl Enterococcus faecalis Streptococcus faecalis 4 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association Fig. 7B pcfg-pcfc 1 3 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 4 unspecified role unspecified role prey prey entfl Enterococcus faecalis Streptococcus faecalis physical association physical association Fig. 7B pcff-pcfg-1 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 3 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig. 7D pcfc-pcfg 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 3 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 7C pcfc-pcff 2 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig. 7C