mbinfo MBInfo http://www.mechanobio.info/ The LIM-domain protein Zyxin binds the homeodomain factor Xanf1/Hesx1 and modulates its activity in the anterior neural plate of Xenopus laevis embryo. The LIM-domain protein Zyxin binds the homeodomain factor Xanf1/Hesx1 and modulates its activity in the anterior neural plate of Xenopus laevis embryo. Dev. Dyn. (1058-8388) 2008 imex curation Martynova N.Y., Eroshkin F.M., Ermolina L.V., Ermakova G.V., Korotaeva A.L., Smurova K.M., Gyoeva F.K., Zaraisky A.G. In the colocalization experiment (Fig. 6), since both the proteins are not visualized in the same image, this data cannot be curated. The coprecipitated proteins were primarily detected by immunoblotting with anti-tag antibodies. But in the instance were microinjected myc-xanf1 were used to precipitate endogenous zyxin (fig. 3 lanes 8,9,10,11), the coprecipitated zyxin was detected with anti-zyxin antibodies. The source of Xanf1, zyxin, XIRG, LANP and Sam68 provided by the authors. Zar@humgen.siobc.ras.ru 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Martynova N.Y., Eroshkin F.M., Ermolina L.V., Ermakova G.V., Korotaeva A.L., Smurova K.M., Gyoeva F.K., Zaraisky A.G. In the colocalization experiment (Fig. 6), since both the proteins are not visualized in the same image, this data cannot be curated. The coprecipitated proteins were primarily detected by immunoblotting with anti-tag antibodies. But in the instance were microinjected myc-xanf1 were used to precipitate endogenous zyxin (fig. 3 lanes 8,9,10,11), the coprecipitated zyxin was detected with anti-zyxin antibodies. The source of Xanf1, zyxin, XIRG, LANP and Sam68 provided by the authors. Zar@humgen.siobc.ras.ru Accepted 2012-MAR-07 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Dev. Dyn. (1058-8388) 2008 Only protein-protein interactions imex curation The LIM-domain protein Zyxin binds the homeodomain factor Xanf1/Hesx1 and modulates its activity in the anterior neural plate of Xenopus laevis embryo. The LIM-domain protein Zyxin binds the homeodomain factor Xanf1/Hesx1 and modulates its activity in the anterior neural plate of Xenopus laevis embryo. Dev. Dyn. (1058-8388) 2008 imex curation Martynova N.Y., Eroshkin F.M., Ermolina L.V., Ermakova G.V., Korotaeva A.L., Smurova K.M., Gyoeva F.K., Zaraisky A.G. In the colocalization experiment (Fig. 6), since both the proteins are not visualized in the same image, this data cannot be curated. The coprecipitated proteins were primarily detected by immunoblotting with anti-tag antibodies. But in the instance were microinjected myc-xanf1 were used to precipitate endogenous zyxin (fig. 3 lanes 8,9,10,11), the coprecipitated zyxin was detected with anti-zyxin antibodies. The source of Xanf1, zyxin, XIRG, LANP and Sam68 provided by the authors. Zar@humgen.siobc.ras.ru 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Martynova N.Y., Eroshkin F.M., Ermolina L.V., Ermakova G.V., Korotaeva A.L., Smurova K.M., Gyoeva F.K., Zaraisky A.G. In the colocalization experiment (Fig. 6), since both the proteins are not visualized in the same image, this data cannot be curated. The coprecipitated proteins were primarily detected by immunoblotting with anti-tag antibodies. But in the instance were microinjected myc-xanf1 were used to precipitate endogenous zyxin (fig. 3 lanes 8,9,10,11), the coprecipitated zyxin was detected with anti-zyxin antibodies. The source of Xanf1, zyxin, XIRG, LANP and Sam68 provided by the authors. Zar@humgen.siobc.ras.ru Accepted 2012-MAR-07 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Dev. Dyn. (1058-8388) 2008 Only protein-protein interactions imex curation The LIM-domain protein Zyxin binds the homeodomain factor Xanf1/Hesx1 and modulates its activity in the anterior neural plate of Xenopus laevis embryo. The LIM-domain protein Zyxin binds the homeodomain factor Xanf1/Hesx1 and modulates its activity in the anterior neural plate of Xenopus laevis embryo. Dev. Dyn. (1058-8388) 2008 imex curation Martynova N.Y., Eroshkin F.M., Ermolina L.V., Ermakova G.V., Korotaeva A.L., Smurova K.M., Gyoeva F.K., Zaraisky A.G. In the colocalization experiment (Fig. 6), since both the proteins are not visualized in the same image, this data cannot be curated. The coprecipitated proteins were primarily detected by immunoblotting with anti-tag antibodies. But in the instance were microinjected myc-xanf1 were used to precipitate endogenous zyxin (fig. 3 lanes 8,9,10,11), the coprecipitated zyxin was detected with anti-zyxin antibodies. The source of Xanf1, zyxin, XIRG, LANP and Sam68 provided by the authors. Zar@humgen.siobc.ras.ru 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Martynova N.Y., Eroshkin F.M., Ermolina L.V., Ermakova G.V., Korotaeva A.L., Smurova K.M., Gyoeva F.K., Zaraisky A.G. In the colocalization experiment (Fig. 6), since both the proteins are not visualized in the same image, this data cannot be curated. The coprecipitated proteins were primarily detected by immunoblotting with anti-tag antibodies. But in the instance were microinjected myc-xanf1 were used to precipitate endogenous zyxin (fig. 3 lanes 8,9,10,11), the coprecipitated zyxin was detected with anti-zyxin antibodies. The source of Xanf1, zyxin, XIRG, LANP and Sam68 provided by the authors. Zar@humgen.siobc.ras.ru Accepted 2012-MAR-07 by ORCHARD 19-Jun-2012: Contacted by JYOTI. cDNA expression library from X. laevis embryos of the late gastrula–early neurula stage Dev. Dyn. (1058-8388) 2008 Only protein-protein interactions imex curation The LIM-domain protein Zyxin binds the homeodomain factor Xanf1/Hesx1 and modulates its activity in the anterior neural plate of Xenopus laevis embryo. The LIM-domain protein Zyxin binds the homeodomain factor Xanf1/Hesx1 and modulates its activity in the anterior neural plate of Xenopus laevis embryo. Dev. Dyn. (1058-8388) 2008 imex curation Martynova N.Y., Eroshkin F.M., Ermolina L.V., Ermakova G.V., Korotaeva A.L., Smurova K.M., Gyoeva F.K., Zaraisky A.G. In the colocalization experiment (Fig. 6), since both the proteins are not visualized in the same image, this data cannot be curated. The coprecipitated proteins were primarily detected by immunoblotting with anti-tag antibodies. But in the instance were microinjected myc-xanf1 were used to precipitate endogenous zyxin (fig. 3 lanes 8,9,10,11), the coprecipitated zyxin was detected with anti-zyxin antibodies. The source of Xanf1, zyxin, XIRG, LANP and Sam68 provided by the authors. Zar@humgen.siobc.ras.ru 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Martynova N.Y., Eroshkin F.M., Ermolina L.V., Ermakova G.V., Korotaeva A.L., Smurova K.M., Gyoeva F.K., Zaraisky A.G. In the colocalization experiment (Fig. 6), since both the proteins are not visualized in the same image, this data cannot be curated. The coprecipitated proteins were primarily detected by immunoblotting with anti-tag antibodies. But in the instance were microinjected myc-xanf1 were used to precipitate endogenous zyxin (fig. 3 lanes 8,9,10,11), the coprecipitated zyxin was detected with anti-zyxin antibodies. The source of Xanf1, zyxin, XIRG, LANP and Sam68 provided by the authors. Zar@humgen.siobc.ras.ru Accepted 2012-MAR-07 by ORCHARD Dev. Dyn. (1058-8388) 2008 Only protein-protein interactions imex curation q7syh0_xenla protein protein xenla Xenopus laevis (African clawed frog) African clawed frog YEDSYAEPSYEGYEGYYSQSQGETEYYDYGHGEGPESYENYGQDNWNGSRPPPLKVPSSRALKGGAYREHPYGRF 99E34738EDD191F4 zyx_xenla Zyxin zyx protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDPAAPATRMTSSFTINISTPSFYNPPKKFAPVVPPKPKINPFKAPEEPQSLVPQENSAGPGLHQAFVGKVGEMPPGVDHDDFVLPPPPPSEESISPPSSSFPPPPPSFGDEGLGSPSGGSFPPPPPPEFSEPFPPPIEEFFPSPPPLEECVSDTQDLPVPVPPPPPPPLPSPPAAPPPKPSAPCEAPKPAPVFPKSSPPPAFPKPEPPSVAPKAASSIFIPKPSAPMAVAPKPLAPPPVAAKPSGPVSFAPPSPAPHTFSPDPSAPAHTFSPKTVTFSPKSAPHTFMPKPSAPVTYPQKTTEPPAEASQSSPKVTPAAKHEAPPPTVPSGGRAPGFSFAQQRERPRVLEKPRANLQGSEPEHEPTVEVQVERTRSLGPQTESGRSPGAQSTGGKDMKPLPEGLRSQKPMSDGIHRTGGQHSGHKVTGQQDQTLGSQGLNMKEVEELEMLTQQLMREMDKPPTAEAHSMELCGFCGRGLSRTETVVRAGEHLYHVACFTCSRCDQQLQGQQYYESAGKPLCDECYQDTLECCAVCDKKITERLLKAIGKSYHPSCFTCAVCKCSLQGEPFIVDDNKLPHCVNDYHRRYAPRCCVCGDPIAPEPGRDETVRVVALEKNFHMMCYKCEDCGCPLSIEADDAGCFPLDGHVLCKKCHTVRARAALG 27158AB024B69B21 hesxb_xenla Homeobox expressed in ES cells 1-B hesx1-b anf-1 anf1 Homeobox protein ANF-1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSPALQKGSSLMENRSPPSSFSIEHILGLDKKTDVASSPIIKHHRPWIECSSKGVVNGTCWQIPVIACDLPIQVHAVHRSEEEETKIRLEKCFGDEDRLTYKRELSWYRGRRPRTAFTRSQIEILENVFRVNSYPGIDVREELASKLALDEDRIQIWFQNRRAKLKRSHRESQFLIVKDSLSSKIQE 0E9BF0988E1AEFB5 q9dgg0_xenla xirg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MFSSTLQNTKKLQQVCRQLHSAALKVAVSPQYEESVTNTFASFITDIRPEHLSDIVRHRSKRMILDNIGVGLVGTTTHVFNIILQYCQDLHSSGYGNTAVSSVYGRKDLMLSPTLAAYVNGVAVHSMDFDDTWHPATHPSGAVVPSILALSQLLSKEKRISGEDLLTAYNVGIEVQGRLMCFSKEAKNIPKKFHPPSVVGTMGSAAAAAKLLSLNKEQCTHALAIAASLAGAPMANAATLSKPLHIGNATRLGLEAALLASRGMEANALILDYVPGCAGFSAFYGDYHPKSLSPAGEDYEFLLEKQDIAFKSFPAHLGMHWIADASVSVRNRLINHYGSFNPSAIQSIILRVPVSKYINRPYPESEHEARHSFQFNACTALLDGEVNISSFNDDNMHRPDLHSLLKKVVLEHPEDNVANFDKMYGEVVIVLKDGDVKIGRTDTFYGHWRNPLSRESLLKKFRSNALHVLEEGQVEDVIEMVENMESVSDVSQLPLSLQ C261C33F23A56077 an32a_xenla Acidic leucine-rich nuclear phosphoprotein 32 family member A anp32a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDMKKRIHLELRNRTPADVKELVLDNCRSKEGKIEGLTDEFEGLEFLSTINVCLSSIANLPKLNKLKKLELSDNNISGGLEVLAEKCPNLTHLNLSGNRIKDLSTIEPLKKLEHLKSLDLFNCEVTNLNDYRENLFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDDEDDEDEDDYDEDVPPGEEGEDDDDEEEGEEEEVSGEEEEDEDASREGEEDEGDEEAEHGEKRKRDQDDEGEDDD 7BFF5E9C2E66AB13 hesx1_b-zyx 4 6 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain The author provides contradictory sequence lengths for zyxin in the text and in the sequence representation. But since the uniprot also has a sequence length of 663 amino acids for Xenopus laevis zyxin, the binding site here would be [373-663] and not [373-664] as provided by the author in the text. 7 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3 (Lanes 1,2,8,9,10 and 11). zyx -hesx1-b 2 7 unspecified role unspecified role prey prey n-terminal region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain The N-terminal region [1-77] contains the Engrailed Homology 1 domain (sequence not provided by authors) which is responsible for the interaction with zyxin. 6 unspecified role unspecified role bait bait lim2 domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 18 20 physical association physical association Fig. 4A and 5A. hesx1_b-zyx-1 1 7 unspecified role unspecified role prey prey n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range xenla-oocyte Xenopus laevis oocyte Oocyte 6 unspecified role unspecified role bait bait lim2 domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 4B and 5B. hesx1_b-zyx-2 4 6 unspecified role unspecified role bait bait c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain The author provides contradictory sequence lengths for zyxin in the text and in the sequence representation. But since the uniprot also has a sequence length of 663 amino acids for Xenopus laevis zyxin, the binding site here would be [373-663] and not [373-664] as provided by the author in the text. n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range eh1 domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain EH1 (Engrailed Homology 1) domain is present within the N-terminal region [1-77] of Xanf1. The specific sequence range is not provided by the authors. 29 33 physical association physical association Fig. 3 (Lanes 3,4) and 5C. hesx1_b-zyx-4 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association hesx1_b-irg1 3 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association The XIRG protein is not annotated in swissprot and thus has been referenced with a TrEMBL identifier. anp32a-hesx1b 3 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association hesx1_b-q7syh0 3 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association The Sam68 protein is not annotated in swissprot and is referenced only by a TrEMBL entry. This TrEMBL entry for Sam68 corresponds to a partial protein sequence and not the full length protein.