mpidb The Microbial Protein Interaction Database DivIVA is required for polar growth in the MreB-lacking rod-shaped actinomycete Corynebacterium glutamicum. DivIVA is required for polar growth in the MreB-lacking rod-shaped actinomycete Corynebacterium glutamicum. J. Bacteriol. (0021-9193) 2008 imex curation Letek M., Ordóñez E., Vaquera J., Margolin W., Flärdh K., Mateos L.M., Gil J.A. Only protein-protein interactions ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Letek M., Ordóñez E., Vaquera J., Margolin W., Flärdh K., Mateos L.M., Gil J.A. Accepted 2013-FEB-03 by ORCHARD J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation div4a_strr6 Cell division protein DivIVA divIVA spr1505 protein protein strr6 Streptococcus pneumoniae (strain ATCC BAA-255 / R6) MPITSLEIKDKTFGTRFRGFDPEEVDEFLDIVVRDYEDLVRANHDKNLRIKSLEERLSYFDEIKDSLSQSVLIAQDTAERVKQAAHERSNNIIHQAEQDAQRLLEEAKYKANEILRQATDNAKKVAVETEELKNKSRVFHQRLKSTIESQLAIVESSDWEDILRPTATYLQTSDEAFKEVVSEVLGEPIPAPIEEEPIDMTRQFSQAEMEELQARIEVADKELSEFEAQIKQEVETPTPVVSPQVEEEPLLIQLAQCMKNQK 446FBA7A863201A5 q8nnn8_corgl Antigen 84 Cell wall synthesis protein Wag31 Cgl2150 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MPLTPADVHNVAFNKPPIGKRGYNEDEVDQFLDLVEDALVQFQEENEDLKQQVEELEAQVAGGTSSAASSSTAGAATAAASKSVDEAALRKEIEEKLRSEYASKLDDASKAAQKAQNDAKSAQDQLQRAQADAKAARDEAEKAKAEAKSAASSSTTKAAAVGAVGAGTGAAVATGAANVDTHMQAAKVLGLAQEMADRLTSEARSESKSMLDEAREAAEKQIEEANSTSNRTLEDARANAEKQIAEAQNRADTLVNEADAKAKNLVSEAEKKSAATLAASTSRAEAQIRQAEDKANALQADAERKHTETMAAVKEQQNALETRIAELQTFEREYRTRLKSLLEGQLEELNARGSSAPTNNKPSGE 91E1E1C4F1E1ABB0 q9s2x4_strco Antigen 84 Cell wall synthesis protein Wag31 SCO2077 protein protein strco Streptomyces coelicolor A3(2) MPLTPEDVRNKQFTTVRLREGYDEDEVDAFLDEVEAELTRLLRENEDLRAKLAAATRAAAQNQQNMRKPPEPPQDQQHQQGPPQHQQGPPQQGGMPQQGMRGPGAPVPAGISGPPQQQMGGPMGGPPQLPSGAPQLPAGPGGQGGPQGPGPMGQGPGPMGQGPGPMQGQMGPGPMGGPMGGPQGPGGPGGPGMPGQGGPGGDSAARVLSLAQQTADQAIAEARSEANKIVGEARSRAEGLERDARAKADALERDAQEKHRVAMGSLESARATLERKVEDLRGFEREYRTRLKSYLESQLRQLETQADDSLAPPRTPATASLPPSPAPSMAPAGASAPSYGGNQSMGGGPGQSGPSYGGQQQMSPAMTQPMAPVRPQGPSPMGQAPSPMRGFLIDEDDN 9AEFB8370035CA91 wag31_myctu Cell wall synthesis protein Wag31 wag31 Antigen 84 ag84 MTCY270.23 Rv2145c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQELAAGGGAGVTPQATQAIPAYEPEPGKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNTAKAESDKMLADARANAEQILGEARHTADATVAEARQRADAMLADAQSRSEAQLRQAQEKADALQADAERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSAAPVDSNADAGGFDQFNRGKN D36113355149CEDC div4a_bacsu Septum site-determining protein DivIVA ylmJ Cell division initiation protein DivIVA Minicell-associated protein DivIVA BSU15420 divIVA protein protein bacsu Bacillus subtilis MPLTPNDIHNKTFTKSFRGYDEDEVNEFLAQVRKDYEIVLRKKTELEAKVNELDERIGHFANIEETLNKSILVAQEAAEDVKRNSQKEAKLIVREAEKNADRIINESLSKSRKIAMEIEELKKQSKVFRTRFQMLIEAQLDLLKNDDWDHLLEYEVDAVFEEKE B62978CA02708F68 diviva-diviva-7 1 2 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Fig. 4 diviva-diviva-6 1 6 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Fig. 4 q9s2x4-q9s2x4 1 4 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig. 4 q9s2x4-ag84 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 4 q9s2x4-q8nnn8 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig. 4 ag84-q9s2x4 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig. 4 ag84-ag84 1 5 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 4 ag84-q8nnn8 1 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Fig. 4 diviva-diviva-8 1 6 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association Fig. 4 diviva-diviva-4 1 6 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig. 4 q8nnn8-q8nnn8 1 3 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Fig. 4 q8nnn8-ag84 1 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 4 q8nnn8-q9s2x4 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Fig. 4