mpidb The Microbial Protein Interaction Database Legionella translocates an E3 ubiquitin ligase that has multiple U-boxes with distinct functions. Legionella translocates an E3 ubiquitin ligase that has multiple U-boxes with distinct functions. Mol. Microbiol. (0950-382X) 2008 imex curation Kubori T., Hyakutake A., Nagai H. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kubori T., Hyakutake A., Nagai H. Accepted 2013-JAN-16 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation Legionella translocates an E3 ubiquitin ligase that has multiple U-boxes with distinct functions. Legionella translocates an E3 ubiquitin ligase that has multiple U-boxes with distinct functions. Mol. Microbiol. (0950-382X) 2008 imex curation Kubori T., Hyakutake A., Nagai H. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kubori T., Hyakutake A., Nagai H. Accepted 2013-JAN-16 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mouse liver cDNA Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation Legionella translocates an E3 ubiquitin ligase that has multiple U-boxes with distinct functions. Legionella translocates an E3 ubiquitin ligase that has multiple U-boxes with distinct functions. Mol. Microbiol. (0950-382X) 2008 imex curation Kubori T., Hyakutake A., Nagai H. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kubori T., Hyakutake A., Nagai H. Accepted 2013-JAN-16 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation clk1_mouse Dual specificity protein kinase CLK1 Clk1 Clk Sty CDC-like kinase 1 Protein kinase STY protein protein mouse Mus musculus Mouse MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCRYDHSKTTDSYYLESRSINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSSGRSGRSSYKSKHRSRHHTSQHHSHGKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKVGGRRVAVKIVKNVDRYCEAAQSEIQVLEHLNTTDPHSTFRCVQMLEWFEHRGHICIVFELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDYTEAYNPKMKRDERTIVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMIQKTRKRRYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLEYDPAKRITLKEALKHPFFYPLKKHT 96FEBC20EC90D8E8 lubx_legph E3 ubiquitin-protein ligase LubX Legionella U-box protein lubX legU2 lpg2830 RING-type E3 ubiquitin transferase LubX protein protein legph Legionella pneumophila subsp. pneumophila MGYRIEMATRNPFDIDHKSKYLREAALEANLSHPETTPTMLTCPIDSGFLKDPVITPEGFVYNKSSILKWLETKKEDPQSRKPLTAKDLQPFPELLIIVNRFVETQTNYEKLKNRLVQNARVAARQKEYTEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFDELYQQIKVYNFYRKREMQKNQIQPSVSSGFGFFSLNFLTSWLWGTEEKKEKTSSDMTY DIP protein Q5ZRQ0 original sequence version: 33 DIP protein Q5ZRQ0 original sequence version: 59 096EE12CF4F58824 lubx-cdk11b 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain Q5ZRQ0:p.Ile45Ala Q5ZRQ0-39-39 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain I A Wed May 02 19:29:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile45ala' Tue Jun 30 17:08:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile45Ala' region Q5ZRQ0-1-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4A lubx-cdk11b-1 1 4 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4B lubx-cdk11b-2 3 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain ecolx Escherichia coli physical association physical association Fig. 4B