MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. J. Biol. Chem. (0021-9258) 2008 Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. suggested by pannic partial coverage rapid curation rat-renal cortex Rattus norvegicus kidney-renal_cortex renal cortex fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. suggested by pannic J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. J. Biol. Chem. (0021-9258) 2008 Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. suggested by pannic partial coverage rapid curation rat-renal cortex Rattus norvegicus kidney-renal_cortex renal cortex anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. suggested by pannic J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. J. Biol. Chem. (0021-9258) 2008 Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. suggested by pannic partial coverage rapid curation rat-outer medulla Rattus norvegicus kidney-outer_medulla kidney outer medulla anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. suggested by pannic J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. J. Biol. Chem. (0021-9258) 2008 Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. suggested by pannic partial coverage rapid curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. suggested by pannic J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation src_rat Proto-oncogene tyrosine-protein kinase Src Src pp60c-src Proto-oncogene c-Src protein protein rat Rattus norvegicus (Rat) Rat MGSNKSKPKDASQRRRSLEPAENVHGAGGAFPASQTPSKPASADGHRGPNAAFVPPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL DIP protein Q9WUD9 original sequence version: 74 DIP protein Q9WUD9 original sequence version: 94 mint homomint 453D1E904EC660A3 cd63_human CD63 antigen Melanoma-associated antigen ME491 Ocular melanoma-associated antigen OMA81H Granulophysin Tetraspanin-30 Lysosomal-associated membrane protein 3 CD63 MLA1 TSPAN30 Lysosome integral membrane protein 1 protein protein human Homo sapiens Human MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM 85AC8E235C6E425F cd63_rat CD63 antigen Cd63 Mast cell antigen AD1 protein protein rat Rattus norvegicus (Rat) Rat MAVEGGMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQKQMQNYLTDNKTATILDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVKSIRSGYEVM mint homomint May be involved in the secretory process of mast cells and may play some role in signal transduction pathways B6F8C8B69E766690 ptpra_rat Receptor-type tyrosine-protein phosphatase alpha Ptpra Lrp protein protein rat Rattus norvegicus (Rat) Rat MDSWFILILFGSGLIHISANNTTTVSPSLGTTRLIKTSTTESAKEENKTSNSTSSVISLSVTPTFSPNLTLEPTYVTTVNSSHSDNGTKRAASTESGGTTISPNGTYGTWLTDNQFTDARTEPWEGNSSSAATTPETFPPADETPIIAVMVALSSLLVILFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNLLPYDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWPYGNVRVSVEDVTVLVDYTVRKFCIQQVGDVTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHSERKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALLEHYLYGDTELEVTSLDTHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGYLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDPYRQKDSYIASQGPLLHTTEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMINIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLECVKAEGILDVFQTVKTLRLQRPHMVQILEQYEFCYKVVQEYIDAFSDYANFK mint 4793796191056920 src_human Proto-oncogene tyrosine-protein kinase Src pp60c-src SRC SRC1 Proto-oncogene c-Src protein protein human Homo sapiens Human MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL DIP protein P12931 original sequence version: 188 DIP protein P12931 original sequence version: 189 DIP protein P12931 original sequence version: 190 DIP protein P12931 original sequence version: 191 DIP protein P12931 original sequence version: 115 DIP protein P12931 original sequence version: 116 DIP protein P12931 original sequence version: 164 DIP protein P12931 original sequence version: 142 DIP protein P12931 original sequence version: 143 DIP protein P12931 original sequence version: 150 DIP protein P12931 original sequence version: 160 DIP protein P12931 original sequence version: 184 DIP protein P12931 original sequence version: 155 DIP protein P12931-1 original sequence version: 155 DIP protein P12931 original sequence version: 202 C1908084683E5DE8 ptpra-cd63 2 RPTP alfa 8 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CD63 7 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2A mint cd63-ptpra 2 RPTP alfa 8 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CD63 7 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2B mint ptpra-cd63-1 3 RPTP alfa 8 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CD63 7 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2A mint cd63-ptpra-1 3 CD63 7 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level RPTP alfa 8 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2B mint ptpra-cd63-2 4 RPTP alfa 8 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CD63 6 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association F2C mint ptpra-src-4 4 RPTP alfa 8 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cSrc 9 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association F4A mint cd63-src 4 cSrc 9 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell CD63 6 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F4B homomint mint ptpra-src-5 2 RPTP alfa 8 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cSrc 5 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F4C mint cd63-src-1 2 CD63 7 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cSrc 5 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F4D homomint mint cd63-src-2 3 CD63 7 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cSrc 5 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F4D homomint mint cd63-ptpra-2 1 RPTP alfa 8 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CD63 7 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization F1 mint