mpidb The Microbial Protein Interaction Database Peptide-assisted degradation of the Salmonella MgtC virulence factor. Peptide-assisted degradation of the Salmonella MgtC virulence factor. EMBO J. (0261-4189) 2008 imex curation Alix E., Blanc-Potard A.B. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Alix E., Blanc-Potard A.B. Accepted 2013-JAN-28 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation h8m0g8_saltm mgtC UMN798_4092 protein protein salmonella enterica subsp. enterica serovar typhimurium str. 798 Salmonella enterica subsp. enterica serovar Typhimurium str. 798 MEERMLMFPYILNLLAAMLLGALIGAERQWRQRMAGLRTNALVATGAAVFILSSMTTSPDSPGRIAAQIVSGIGFLGAGVIMREGMNVRGLNTAATLWCSAGIGVLCGLGQFKNALAATIIILCANILLREAAQRINQLPISAEGEKRYILKVTCNKEDESAVRQWLLNIVKEAAICLQGLGSVPAQEQGYKEIRAELVGHADYRKTRELIISRIGDNDNITAIHWSIDSQ The sequence has been withdrawn from uniprot. 247DB4DCC3BFDB3D b0ljc7_saltm AL184_09675 AQ530_12505 AVA38_16520 JJB80_18925 JJB81_18920 ADQ28_15845 AF497_03590 AGM99_05020 AHN93_11550 AKH62_08645 AL144_07815 mgtR AU613_17895 CVR97_16110 G0042_11615 G0045_09830 G0038_05935 G0040_17545 A3S30_02985 A3T81_03525 A3U32_14785 A3V03_16125 A3V89_00265 A3W57_03410 A3W75_06465 A3X15_00265 A3X55_04140 A3Y76_07380 A4N07_07425 A4O05_16735 A4O41_15990 A4R48_20315 A6D61_11445 AAA76_11270 AAB27_10735 AAB79_15990 AAC35_03045 A3104_21635 G0047_04995 AL168_13845 DRM14_09050 CIX60_11100 CPS79_04025 CQO33_02100 CSG22_20605 D4361_00270 D4387_02350 D4422_07400 D5823_19445 D5N86_06985 D5N95_00270 D5O82_09480 D5P17_09095 D5X47_03140 D5Y28_11265 D6422_07150 D6J79_02605 D8S24_00270 DLB93_00270 DLR28_04055 DMI89_17350 DMO92_11155 DN165_05395 DNB97_16385 DNM27_07450 DNZ37_00270 DO533_10975 DP680_00270 DPB42_14070 DPD91_16560 DPF41_12190 DPF68_05980 DPS76_06470 DQD22_05480 DQR44_03145 DRR75_12995 DRT38_09550 DRT61_12235 DRV05_06485 DSF94_02580 DSG41_20825 DTF68_09155 DU071_08040 DU223_00210 DU657_14965 DU879_06325 DUV75_04800 DWU22_19085 DY580_08690 DYM27_12375 E0935_00265 E1A11_05295 E6W45_04920 EBD14_00270 EBK21_05680 EC404_07480 EEQ30_13385 EER35_18580 EHB09_17265 EL822_05510 ELS01_05785 EPB30_05570 EQG93_07855 EVY71_23305 EW905_00205 F0D96_11720 F2P00_06635 F3Q97_07980 F3R12_09375 F9G02_17475 F9O44_10115 FE758_16345 FEM52_11525 FGZ46_07465 FJM64_04390 FQC24_04560 GCZ80_14595 GEZ01_02415 KP44_05040 NG06_03210 R035_07365 SE14_03986 Z700_02985 ZV33_03010 ZX03_14740 ZY40_20380 AVC05_03315 AVL16_06950 AWT30_07850 AXX99_20755 B1265_04780 B1398_07835 B1642_06635 B1P38_09475 B2E31_11540 B4V59_11255 B4W90_05155 B6362_02635 B7Q27_04775 B8Y16_02920 B8Z46_05600 B9C90_13760 B9C96_19390 B9M14_04585 B9O84_10035 BBQ66_19105 BIC00_16700 BIC13_02640 BK110_04975 BKM50_17565 BMS46_12070 BMU56_20230 BZ203_16410 BZZ88_15885 C5W43_16265 CA117_13610 CB102_20605 CB119_16535 CB198_11290 CB380_17270 CB535_00205 CB570_01260 CB646_00305 CBM67_03760 CBM76_13090 CBZ90_15315 CC339_14535 CC403_03605 CC453_00260 CC652_10230 CC971_07675 CCP17_05040 CDZ72_00265 CE70_04765 CED07_08960 CEQ70_11200 CFF58_22345 CFF59_19145 CHN22_12300 H8S97_19240 STMLT2P22_CBEKMEGD_04532 G4F88_00400 G4F89_00400 G4F91_00400 G4F92_00400 G0048_08500 G0051_05065 G0052_10255 G0059_05340 G0061_07590 G0062_08175 G0063_08055 G0067_08670 G0069_08245 G0070_17365 G0071_06605 G0072_13895 G0074_09645 G0076_06890 G0077_08430 G0080_10295 G0084_11055 G0086_10555 G0087_08500 G0088_07595 G0089_24080 G0090_03160 G0094_03390 G0100_23495 G0101_07695 G0102_07385 G0111_07015 G0113_08485 G0117_05220 G0123_08500 G0124_08235 G0148_07260 G0157_07915 G0170_09235 G0A05_13465 G0A28_19710 G0A32_12935 G0A39_19435 G0A43_18535 G0A44_22005 G0A46_20695 G0A50_13175 G0A51_13585 G0A52_20540 G0A53_12190 G0A56_21880 G0A58_11885 G0A60_12000 G0A61_12195 G0A63_10865 G0A66_13250 G0A67_15600 G0A68_11070 G0A70_12485 G0A73_21760 G0A76_09520 G0A79_14330 G0A85_14015 G0A88_05650 G0A92_05995 G0A96_05480 G0A97_12595 G0A99_15830 G0B03_05755 G0B05_02210 G0B07_02115 G0B08_22270 G0B12_00270 G0B28_19705 G0B96_05725 G0C03_02580 G0C04_06580 G0C34_07960 G0E15_12315 G0E20_21735 G0G84_04820 G0J24_04465 G0J26_07870 G0J27_01500 G0J28_05640 G0J31_20425 G0J33_04135 G0J34_08915 G0J36_05940 G0J37_08655 G0J40_07480 G0J43_04600 G0J44_08770 G0J45_05905 G0J46_06415 G0J47_08535 G0J49_06675 G0J50_09375 G0J51_07515 G0J53_02645 G0J55_05355 G0J58_03640 G0J59_15880 G0J62_08645 G0J65_11135 G0J66_02310 G0J67_05505 G0J69_02440 G0J71_02440 G0J73_11675 G0J76_02450 G0J79_18680 G0J81_05130 G0J82_06755 G0J85_05130 G0J89_11605 G0J92_10850 G0J94_12015 G0J96_10420 G0J97_14985 G0K00_17405 G0K02_07690 G0K03_06270 G0K04_14300 G0K05_08960 G0K07_02440 G0K10_06865 G0K13_05545 G0K15_04080 G0K16_10790 G0K18_14385 G0K19_03060 G0K20_11225 G0K23_06260 G0K25_00270 G0K26_17435 G0K28_11675 G0K30_05660 G0K31_02255 G0K32_18505 G0K33_05040 G0K37_00270 G0K38_09810 G0K39_15865 G0K41_24910 G0K42_07855 G0K44_16905 G0K46_05130 G0K47_19030 G0K48_11010 G0K49_11800 G0K52_12995 G0K53_13150 G0K56_11460 G0K58_10230 G0K59_12535 G0K61_08190 G0K65_06480 G0K68_04415 G0K70_15755 G0K72_03385 G0K74_12265 G0K75_06370 G0K78_16950 G0K80_12855 G0K83_04995 G0K84_13190 G0K85_10160 G0K88_003396 G0K89_003530 G0K90_003546 G0K94_003550 G0K95_000582 G0L00_004422 G0L02_003952 G0L03_14305 G0L06_13450 G0L07_18640 G0L10_20145 G0L14_03255 G0L15_17085 G0L18_03360 G0L19_03725 G0L20_14880 G0L24_18160 G0L25_16450 G0L29_15070 G0L31_14455 G0L32_08720 G0L34_08135 G0L35_20825 G0L36_14975 G0L37_09140 G0L38_11520 G0L40_21065 G0L42_16930 G0L48_07630 G0L49_02500 G0L51_19920 G0L52_20690 G0L55_18780 G0L59_17865 G0L62_19995 G0L63_18280 G0L65_11045 G0L67_13100 G0L68_20095 G0L70_08010 G0L73_13615 G0L76_17580 G0L77_11230 G0L78_19515 G0L79_11735 G0L83_10315 G0L85_09120 G0L86_003754 G0L88_19905 G0L89_19085 G0L91_20030 G0L93_18420 G0L96_20265 G0L98_18255 G0M00_19600 G0M05_17195 G0M06_003551 G0M13_003929 G0M14_14530 G0M16_18575 G0M18_003281 G0M21_14995 G0M22_004254 G0M25_003795 G0M26_12955 G0M27_20615 G0M28_18505 G0M29_003522 G0M30_17390 G0M33_09755 G0M35_12365 G0M36_18280 G0M38_18120 G0M39_09090 G0M40_12295 G0M41_09810 G0M45_11190 G0M46_001956 G0M48_003558 G0M51_07615 G0M53_09980 G0M55_20380 G0M56_20175 G0M58_21395 G0M63_20240 G0M65_20400 G0M67_11175 G0N45_04410 G0N48_08290 G0N51_11695 G0N53_03520 G0N55_07055 G0N57_13500 G0N58_04090 G0N59_10035 G0N60_09110 G0N61_04995 G0N62_04570 G0N64_06680 G0N65_05620 G0N66_21120 G0N67_06700 G0N71_07695 G0N75_10050 G0N78_06165 G0N82_06265 G0N84_07235 G0N85_03520 G0N86_10690 G0N88_07115 G0N89_05715 G0N90_07195 G0N92_11330 G0N94_07605 G0N95_15475 G0N98_08985 G0N99_10150 G0O00_03355 G0O03_07000 G0O10_06225 G0O14_10995 G0O15_13315 G0O18_14175 G0O19_08830 G0O20_17455 G0O22_05155 G0O25_20085 G0O27_07055 G0O31_07600 G0O32_21365 G0O36_21555 G0O37_07805 G0O39_04990 G0O40_12910 G0O41_07470 G0O42_07590 G0O43_08535 G0O44_04950 G0O47_08050 G0O52_21705 G0O55_06770 G0O57_07335 G0O58_09470 G0O59_13670 G0O60_08820 G0O63_04405 G0O66_12990 G0O68_06815 G0O70_08245 G0O71_08250 G0O74_07220 G0O75_06935 G0O77_08090 G0O78_07860 G0O80_06985 G0O81_02890 G0O82_09700 G0O84_08245 G0O85_05195 G0O86_09800 G0O87_07390 G0O88_03270 G0O89_05435 G0O92_08355 G0O93_03660 G0O94_12785 G0O97_09045 G0O99_10930 G0P00_14420 G0P01_14695 G0P02_06065 G0P05_12335 G0P06_07775 G0P08_08470 G0P12_12725 G0P13_05100 G0P17_06180 G0P18_07060 G0P19_04895 G0P24_11825 G0P26_08250 G0P28_08320 G0P30_07980 G0P31_10295 G0P36_13365 G0P37_11555 G0P41_13590 G0P44_12200 G0P45_14315 G0P48_07385 G0P49_11215 G0P52_05065 G0P53_09275 G0P56_09430 G0P57_08250 G0P58_04410 G0P63_13685 G0P65_04300 G0P67_09545 G0P68_15055 G0P69_13410 G0P73_11990 G0P75_19500 G0P76_20930 G1N61_05380 G1N64_05295 G1N66_05285 G1N68_05290 G1N71_05305 G1N72_05295 G1N86_05305 G1N87_05305 G1N91_06020 G1O00_02465 G1O02_05300 G1O04_05305 G1O05_05295 G1O08_05285 G1O10_07385 G1O12_05305 G1O16_05300 G1O17_05375 G1O18_05300 G1O20_05305 G1O23_05305 G1O25_05285 G1O26_05305 G1O27_05365 G1O28_05380 G1O29_05365 G1O32_05285 G1O34_05375 G1O38_05710 G1O40_05305 G1O43_05290 G1O46_02460 G1O48_05380 G1O49_05375 G1O51_05300 G1O53_05360 G1O62_05300 G1O63_05290 G1O65_05380 G1O67_21685 G1O68_05305 G1O69_05305 G1O71_17995 G1O72_05380 G1O76_05380 G1O77_05305 G1O80_05375 G1O81_05300 G1O83_05370 G1O84_05380 G1O87_05380 G1O88_05380 G1O89_05305 G1O90_05380 G1O93_05370 G1O94_05365 G1O96_05375 G1P02_05365 G1P03_05405 G1P06_05360 G1P09_03095 G1P10_05305 G1P12_05380 G1P14_00270 G1P15_07500 G1P17_05380 G1P19_05375 G1P23_05375 G1P24_05295 G1P25_05380 G1P26_05300 G1P29_05385 G1P31_05360 G1P35_05305 G1P36_05300 G1P37_05330 G1P40_02535 G1P44_05300 G1P45_05370 G1P47_05375 G1P48_05380 G1P51_05380 G1P52_05330 G1P53_05330 G1P54_05380 G1P55_05375 G1P56_05360 G1P57_05380 G1P58_05365 G1P59_05380 G1P61_07785 G1P64_05380 G1P67_05375 G1P69_05285 G1P72_23710 G1P75_05305 G1P76_05290 G1P78_03110 G1P83_03125 G1P84_05300 G1P87_05370 G1P90_05125 G1P91_05365 G1Q03_05300 G1Q08_04595 G1Q67_05370 G1Q78_20945 G1Q81_05375 G1Q83_05380 G1Q84_05035 G1Q85_05335 G1Q86_05290 G1Q88_02465 G1Q90_05365 G1Q91_05305 G1Q93_04360 G1Q96_05270 G1Q98_05305 G1Q99_05365 G1R01_05285 G1R02_02465 G1R03_05375 G1R04_05380 G1R08_05355 G1R13_04860 G1R15_04455 G1R20_03255 G1R21_05060 G1R22_02540 G1R23_03095 G1R27_05280 G1R28_05380 G1R29_05375 G1R30_05380 G1R31_05575 G1R36_05380 G1R38_05300 G1R40_02540 G1R42_02465 G1R44_05375 G1R45_07060 G1R47_03110 G1R48_11715 G1R51_05290 G1R52_19340 G1R53_05360 G1R63_05380 G1R69_00270 G1R87_03095 G1R93_05290 G1S02_05380 G2203_07420 G2212_08800 G2218_11085 G2221_13855 G2279_11460 G2290_12060 G2793_12980 G2918_12940 G2951_05630 G3221_002467 G3230_003356 G3231_003130 G3247_001593 G3248_002526 G3254_003968 G3263_002779 G3270_002864 G3275_000613 G3312_001221 G3336_001489 G3357_001545 G3369_002123 G3433_003285 G3460_000054 G3464_003265 G3593_001888 G3A35_05430 G3V06_004279 G3V14_002998 G3V17_003956 G3V21_001426 G3V56_000442 G3V57_002651 G3X03_004117 G4189_000944 G4190_003981 G4192_004409 G4198_002577 G4201_001984 G4202_001358 G4A01_001706 G4A73_003805 G4A83_001813 G4A85_000677 G4A87_001011 G4B68_003753 G4B72_003633 G4B74_000564 G4C74_000614 G4D32_004273 G4D46_004014 G4G47_002576 G4G62_001626 G4G67_002561 G4G68_003577 G4G75_001560 G4G76_003781 G4G79_002553 G4G97_004283 G4H00_000676 G4H04_005060 G4H07_003545 G4H08_003666 G4H18_000614 G4H21_000614 G4H24_000613 G4I66_002837 G4J07_001609 G4J08_001580 G4J11_002939 G4J12_003196 G4J18_004394 G4J20_002965 G4J37_003108 G4J39_003172 G4J41_002979 G4J45_002331 G4J90_001595 G4K02_003676 G4K03_001908 G4O54_004306 G4O56_001453 G4O59_004205 G4O60_004416 G4O67_003638 G4O69_004097 G4P29_002973 G4P83_001734 G4P85_000676 G4P89_003638 G4P91_003592 G4P93_003018 G4Q12_001808 G4Q28_000613 G4Q31_000611 G4Q50_002025 G4Q52_001659 G4Q59_002689 G4Q60_000676 G4Q63_002123 G4Q67_003542 G4Q94_003034 G4R01_000675 G4R02_003784 G4R15_003732 G4R16_000620 G4W68_002141 G4W73_000438 G4W86_003914 G4W87_000613 G4W88_000613 G4W91_000054 G4Y10_003184 G9269_000717 G9302_000676 G9304_003114 G9305_002542 G9309_003370 G9313_000676 G9314_003374 G9367_001357 G9381_002978 G9C24_000265 G9C41_004204 G9C46_002371 G9C47_004430 G9C49_004033 G9C57_000611 G9C64_003819 G9G03_004142 G9G04_002994 G9G34_001912 G9G36_003869 G9G45_002342 G9G50_002766 G9G62_002937 G9W19_002481 G9W28_001554 G9W45_002752 G9W52_002675 G9W63_002113 G9W65_000611 G9W79_002023 G9W95_000614 G9W96_003651 G9X40_002058 GB021_11465 GB040_06430 GB055_07870 GB076_10085 GB106_05355 GB114_07845 GB120_04980 GB122_13385 GB131_17645 GB139_06295 GB171_03555 GB209_07420 GB221_07290 GB224_04095 GB238_15205 GB280_05065 GB321_06940 GB331_17250 GB339_12630 GB342_04515 GB368_11635 GB372_11755 GB416_12140 GB452_05555 GB459_13640 GB466_11435 GB505_11315 GB510_07870 GB551_03625 GB567_15500 GB645_19245 GBS44_10685 GBS58_05445 GBV53_15270 GBV54_10360 GBV60_02355 GBW03_18960 GBW44_14350 GBW52_03950 GBW76_13185 GBX12_20750 GBX20_14370 GBX46_07710 GBX55_07065 GBX64_03380 GBY13_10645 GBY23_14765 GBY73_05495 GBZ51_19380 GBZ55_19850 GJE27_05075 GJE28_03950 GNA59_004065 GNA88_002601 GNA97_002748 GNA99_002315 GNB28_002643 GNB36_000507 GNB86_003985 GNB92_002555 GNC11_000610 GNC19_004418 GNC45_003971 GNC75_004032 GNC95_004348 GT380_04865 GTH60_03270 GTH62_18940 GTH63_07750 GTH66_07855 GTH67_16695 GTH68_08180 GTH70_18030 GTH72_22385 GTH73_04995 GTH75_05725 GTH77_17970 GTH78_08195 GTH79_13170 GTH81_12815 GTH85_08490 GTH87_08820 GTH89_20355 GTH90_19025 GTH91_16050 GTH93_08245 GTH94_05245 GTH99_09880 GXC51_04950 GXC56_04950 GXG40_04950 GYI58_10150 GYI62_000619 GYI77_08640 GYJ04_09650 GYJ24_19820 GYJ27_19040 GYJ28_002655 GYJ30_09455 GYJ32_10750 GYJ53_05375 GYJ59_04895 GYJ60_05365 protein protein saltm Salmonella typhimurium MNRSPDKIIALIFLLISLLVLCLALWQIVF EFB1972700AC076F mgtc-mgtr 1 2 unspecified role unspecified role bait bait glu84ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A asn92thr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N T gly85ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G A gly108phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G F 3 unspecified role unspecified role prey prey B0LJC7:p.Leu15Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L P Wed May 02 18:22:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu15pro' Tue Jun 30 17:17:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu15Pro' B0LJC7:p.Ser17Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S L Wed May 02 17:51:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser17leu' Tue Jun 30 15:47:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser17Leu' B0LJC7:p.Ala24Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A L Wed May 02 16:03:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala24leu' Tue Jun 30 19:59:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala24Leu' B0LJC7:p.Ala10Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A L Wed May 02 17:46:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala10leu' Tue Jun 30 18:44:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala10Leu' B0LJC7:p.Ala24Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A P Wed May 02 20:08:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala24pro' Tue Jun 30 15:45:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala24Pro' physical association physical association Fig. 8