mpidb The Microbial Protein Interaction Database Dimerization or oligomerization of the actin-like FtsA protein enhances the integrity of the cytokinetic Z ring. Dimerization or oligomerization of the actin-like FtsA protein enhances the integrity of the cytokinetic Z ring. Mol. Microbiol. (0950-382X) 2007 imex curation Shiomi D., Margolin W. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecod1 Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIB 12045 / K12 / DH1) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Shiomi D., Margolin W. Accepted 2013-JAN-04 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2007 Only protein-protein interactions imex curation ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD DIP protein P0A9A6 original sequence version: 83 DIP protein P0A9A6 original sequence version: 82 DIP protein P0A9A6 original sequence version: 72 B3A53340367DBBA0 ftsa_ecoli Cell division protein FtsA ftsA divA b0094 JW0092 protein protein ecoli Escherichia coli (strain K12) MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF DIP protein P0ABH0 original sequence version: 67 C2475377A229B982 ftsn_ecoli Cell division protein FtsN ftsN msgA b3933 JW3904 protein protein ecoli Escherichia coli (strain K12) MAQRDYVRRSQPAPSRRKKSTSRKKQRNLPAVSPAMVAIAAAVLVTFIGGLYFITHHKKEESETLQSQKVTGNGLPPKPEERWRYIKELESRQPGVRAPTEPSAGGEVKTPEQLTPEQRQLLEQMQADMRQQPTQLVEVPWNEQTPEQRQQTLQRQRQAQQLAEQQRLAQQSRTTEQSWQQQTRTSQAAPVQAQPRQSKPASSQQPYQDLLQTPAHTTAQSKPQQAAPVARAADAPKPTAEKKDERRWMVQCGSFRGAEQAETVRAQLAFEGFDSKITTNNGWNRVVIGPVKGKENADSTLNRLKMAGHTNCIRLAAGG DIP protein P29131 original sequence version: 125 21CEA5771FF3FB66 ftsa-ftsa-2 1 3 unspecified role unspecified role bait bait P0ABH0:p.Arg286Trp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R W Wed May 02 15:13:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg286trp' Tue Jun 30 16:34:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg286Trp' P0ABH0:p.Met71Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M A Wed May 02 17:27:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met71ala' Tue Jun 30 17:09:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met71Ala' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P0ABH0:p.Glu69Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E P Wed May 02 14:33:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu69pro' Tue Jun 30 18:16:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu69Pro' 3 unspecified role unspecified role prey prey P0ABH0:p.Glu69Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E P Wed May 02 18:38:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu69pro' Tue Jun 30 15:48:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu69Pro' P0ABH0:p.Met71Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M A Wed May 02 14:34:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met71ala' Tue Jun 30 18:11:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met71Ala' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P0ABH0:p.Arg286Trp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R W Wed May 02 18:01:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg286trp' Tue Jun 30 19:49:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg286Trp' physical association physical association Table 2 ftsa-ftsz-3 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P0ABH0:p.Glu69Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E P Wed May 02 19:54:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu69pro' Tue Jun 30 16:16:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu69Pro' P0ABH0:p.Arg286Trp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R W Wed May 02 17:01:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg286trp' Tue Jun 30 19:59:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg286Trp' physical association physical association Table 2 ftsa-ftsn-1 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait P0ABH0:p.Met71Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M A Wed May 02 16:03:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met71ala' Tue Jun 30 18:23:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met71Ala' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P0ABH0:p.Glu69Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E P Wed May 02 14:36:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu69pro' Tue Jun 30 16:40:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu69Pro' physical association physical association Table 2