mpidb The Microbial Protein Interaction Database Maltose binding protein (MalE) interacts with periplasmic loops P2 and P1 respectively of the MalFG subunits of the maltose ATP binding cassette transporter (MalFGK(2)) from Escherichia coli/Salmonella during the transport cycle. Maltose binding protein (MalE) interacts with periplasmic loops P2 and P1 respectively of the MalFG subunits of the maltose ATP binding cassette transporter (MalFGK(2)) from Escherichia coli/Salmonella during the transport cycle. Mol. Microbiol. (0950-382X) 2007 imex curation Daus M.L., Berendt S., Wuttge S., Schneider E. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink ms participant Identification by mass spectrometry ms participant Daus M.L., Berendt S., Wuttge S., Schneider E. Accepted 2013-JAN-04 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2007 Only protein-protein interactions imex curation malf_ecoli Maltose/maltodextrin transport system permease protein MalF malF b4033 JW3993 protein protein ecoli Escherichia coli (strain K12) MDVIKKKHWWQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKATRMKFD DIP protein P02916 original sequence version: 123 DIP protein P02916 original sequence version: 114 895CEA1986CE5C0B male_salty Maltose/maltodextrin-binding periplasmic protein malE MMBP Maltodextrin-binding protein Maltose-binding protein STM4229 protein protein salty Salmonella typhimurium MKIKTGVGILALSALTTMMISAPALAKIEEGKLVIWINGDKGYNGLAEVGKKFEQDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEVTPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLVPNPPKTWEEIPALDKELKVKGKSAIMFNLQEPYFTWPLIAADGGYAFKFENGKYDVKDVGVDNAGAKAGLTFLIDMIKNKNMSADTDYSIAEAAFNKGETAMTINGPWAWSNIDKSKVNYGVTLLPTFKGKPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDQGLEAVNKDKPLGAVALKSFQEQLAKDPRIAATMDNAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALKDAQSRITK 2D76BAD17BC502A9 malg_ecoli Maltose/maltodextrin transport system permease protein MalG JW3992 b4032 malG protein protein ecoli Escherichia coli (strain K12) MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG DIP protein P68183 original sequence version: 76 DIP protein P68183 original sequence version: 67 E54418E91E344A29 male-malg 1 3 unspecified role unspecified role neutral component neutral component P19576:p.Ser237Cys mutation mutation certain certain sequence position certain certain certain sequence position certain S C Wed May 02 19:12:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser237cys' Tue Jun 30 16:36:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser237Cys' P19576:p.Gly39Cys mutation mutation certain certain sequence position certain certain certain sequence position certain G C Wed May 02 14:46:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly39cys' Tue Jun 30 17:38:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly39Cys' P19576:p.Phe243Cys mutation mutation certain certain sequence position certain certain certain sequence position certain F C Wed May 02 20:02:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe243cys' Tue Jun 30 16:24:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe243Cys' 4 unspecified role unspecified role neutral component neutral component P68183:p.Pro78Cys mutation mutation certain certain sequence position certain certain certain sequence position certain P C Wed May 02 16:08:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro78cys' Tue Jun 30 17:18:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro78Cys' direct interaction direct interaction Figs 3-5 male-malf 1 2 unspecified role unspecified role neutral component neutral component P02916:p.Ser252Cys mutation mutation certain certain sequence position certain certain certain sequence position certain S C Wed May 02 17:39:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser252cys' Tue Jun 30 17:05:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser252Cys' P02916:p.Ser205Cys mutation mutation certain certain sequence position certain certain certain sequence position certain S C Wed May 02 17:13:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser205cys' Tue Jun 30 17:36:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser205Cys' 3 unspecified role unspecified role neutral component neutral component P19576:p.Phe243Cys mutation mutation certain certain sequence position certain certain certain sequence position certain F C Wed May 02 18:08:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe243cys' Tue Jun 30 20:25:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe243Cys' P19576:p.Gly39Cys mutation mutation certain certain sequence position certain certain certain sequence position certain G C Wed May 02 19:20:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly39cys' Tue Jun 30 19:53:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly39Cys' P19576:p.Ser237Cys mutation mutation certain certain sequence position certain certain certain sequence position certain S C Wed May 02 15:54:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser237cys' Tue Jun 30 18:38:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser237Cys' direct interaction direct interaction Figs 3-5