mpidb The Microbial Protein Interaction Database Mapping critical interactive sites within the periplasmic domain of the Vibrio cholerae type II secretion protein EpsM. Mapping critical interactive sites within the periplasmic domain of the Vibrio cholerae type II secretion protein EpsM. J. Bacteriol. (0021-9193) 2007 imex curation Johnson T.L., Scott M.E., Sandkvist M. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Johnson T.L., Scott M.E., Sandkvist M. Accepted 2013-JAN-03 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation Mapping critical interactive sites within the periplasmic domain of the Vibrio cholerae type II secretion protein EpsM. Mapping critical interactive sites within the periplasmic domain of the Vibrio cholerae type II secretion protein EpsM. J. Bacteriol. (0021-9193) 2007 imex curation Johnson T.L., Scott M.E., Sandkvist M. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Johnson T.L., Scott M.E., Sandkvist M. Accepted 2013-JAN-03 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation gspl_vibch Type II secretion system protein L Cholera toxin secretion protein EpsL General secretion pathway protein L VC_2725 epsL protein protein vibch Vibrio cholerae MEGSVSEFLTVRLSSQKEADIPWLVWSAEQQEVIASGQVAGWEALHEIESYADQRSVVVLLAASDLILTSVEIPPGASRQLENMLPYLLEDEIAQDVEDVHFCVLSKGRETADVVGVDRLWLRACLDHLKACGFDVKRVLPDVLAIPRPEHGLAALQLGDEWLVRKSTTQGMAVDAQWLSLLAASDWVQNEGEYLPLQALTPLPELSLAETQEWRYEPSGLVMQLLTQEALTSKFNLLTGSFKLKSSWLRYWQIWRKVAIAAGLFVAVSISYSLFQAHQYEAQADAYRAESERIFRSIFPDKQKIPTVTYLKRQMSDEMARLSGGASVGSVLKWLSPLPEALKGVNLQLQSIKFDSNRSEIRLEATSRDFQSFEQARTQLEQYFAVEQGQLNKNGEQVFGVFVVKPK 0D408BEC40AF41DB gspm_vibch Type II secretion system protein M Cholera toxin secretion protein EpsM General secretion pathway protein M VC_2724 epsM protein protein vibch Vibrio cholerae MKELLAPVQAWWRSVTPREQKMVMGMGALTVLAIAYWGIWQPLSERTAQAQARLQTEKQLLSWVSENANDIVTLRAQGGSDAPSDQPLNQVITNSTRQFNIELIRVQPRGEMMQVWIQPLPFSQLVSWIAYLQERQGVSVDAIDIDRGKVNGVVEVKRLQLKRGG 8456C7317CE6F515 epsl-epsm 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 6 epsm-epsm 2 4 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association epsl-epsm-1 1 4 unspecified role unspecified role prey prey etxb fusion fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait physical association physical association Fig. 7