mpidb The Microbial Protein Interaction Database The flagellar muramidase from the photosynthetic bacterium Rhodobacter sphaeroides. The flagellar muramidase from the photosynthetic bacterium Rhodobacter sphaeroides. J. Bacteriol. (0021-9193) 2007 imex curation de la Mora J., Ballado T., González-Pedrajo B., Camarena L., Dreyfus G. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot de la Mora J., Ballado T., González-Pedrajo B., Camarena L., Dreyfus G. Accepted 2013-JAN-03 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation The flagellar muramidase from the photosynthetic bacterium Rhodobacter sphaeroides. The flagellar muramidase from the photosynthetic bacterium Rhodobacter sphaeroides. J. Bacteriol. (0021-9193) 2007 imex curation de la Mora J., Ballado T., González-Pedrajo B., Camarena L., Dreyfus G. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot de la Mora J., Ballado T., González-Pedrajo B., Camarena L., Dreyfus G. Accepted 2013-JAN-03 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation f5m061_rhosh RSWS8N_05575 protein protein rhodobacter sphaeroides ws8n Rhodobacter sphaeroides WS8N MRFALVLILTLLAAPALAADEGCETLAARAGAEAGIPEGLMEAIARVESGRGGRAWPWTLNQGGRGMFFETRAEAVRMLQATVASGVSNIDVGCMQLNWRWHAPAFASADEMIDPVRNTRHAARFLRELRARLGSWEAATAAYHSADRGRGAAYLAKVEAERGGSRLAEAATDLPDEATLAAARVQGILVLAPQPMVSLGETQGGLPRAASDIPSQGPLELRAAAPDLLAEADLPQRLRARFHAVQSFRDLLAMQP The sequence has been withdrawn from uniprot. 6DF2D8D17496BDCD f5m064_rhosh RSWS8N_05590 protein protein rhodobacter sphaeroides ws8n Rhodobacter sphaeroides WS8N MELKLQALTPLSLSGSRAQPAGREDLRQAAEGFESLFLTQLLKAGRAGLPGGDLLGSSGVDTARDMLDMELAKSSAGRAGLGIADAIERQFAPLVRDGKS The sequence has been withdrawn from uniprot. 25A75337CE575502 f5m061-f5m064 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Fig. 5A f5m061-f5m064-1 2 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Fig. 5B