mpidb The Microbial Protein Interaction Database Structure-function analysis of the C-terminal domain of LcrV from Yersinia pestis Structure-function analysis of the C-terminal domain of LcrV from Yersinia pestis J. Bacteriol. (ISSN:0021-9193) 2007 imex curation Hamad MA , Nilles ML An LcrV library was screened for mutants that failed to interact with LcrG in a yeast two-hybrid system 18-Dec-2012: Contacted by IntAct-Help. Random five-amino-acid insertions were created in LcrV using transposon-mediated linker insertion mutagenesis Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hamad MA , Nilles ML An LcrV library was screened for mutants that failed to interact with LcrG in a yeast two-hybrid system Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Random five-amino-acid insertions were created in LcrV using transposon-mediated linker insertion mutagenesis J. Bacteriol. (ISSN:0021-9193) 2007 Only protein-protein interactions imex curation Structure-function analysis of the C-terminal domain of LcrV from Yersinia pestis Structure-function analysis of the C-terminal domain of LcrV from Yersinia pestis J. Bacteriol. (ISSN:0021-9193) 2007 imex curation Hamad MA , Nilles ML An LcrV library was screened for mutants that failed to interact with LcrG in a yeast two-hybrid system 18-Dec-2012: Contacted by IntAct-Help. Random five-amino-acid insertions were created in LcrV using transposon-mediated linker insertion mutagenesis Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hamad MA , Nilles ML An LcrV library was screened for mutants that failed to interact with LcrG in a yeast two-hybrid system Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Random five-amino-acid insertions were created in LcrV using transposon-mediated linker insertion mutagenesis J. Bacteriol. (ISSN:0021-9193) 2007 Only protein-protein interactions imex curation lcrg_yerpe Low calcium response locus protein G YPCD1.32c YP_pCD51 y0049 y5046 lcrG protein protein yerpe Yersinia pestis MKSSHFDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAVMKIFAGRSAEEIKPAERELLDEIKRQRERQPQHPYDGKRPRKPTMMRGQII 5E21543540EBF92B lcrv_yerpe Virulence-associated V antigen lcrV icrV Low calcium response locus protein V YPCD1.31c y5047 y0050 YP_pCD52 protein protein yerpe Yersinia pestis MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKNIDISIKYDPRKDSEVFANRVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVKEFLESSPNTQWELRAFMAVMHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAELTAELKIYSVIQAEINKHLSSSGTINIHDKSINLMDKNLYGYTDEEIFKASAEYKILEKMPQTTIQVDGSEKKIVSIKDFLGSENKRTGALGNLKNSYSYNKDNNELSHFATTCSDKSRPLNDLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTSGK 8561A9A0C1A2E169 lcrv-lcrg 1 4 unspecified role unspecified role bait bait P0C7U7:p.Ser277_Arg278insSerMetArgProGln P0C7U7-290-311 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain SR SSMRPQR Wed May 02 16:49:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser277ser_ser_met_arg_pro_gln' Tue Jun 30 19:05:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser277_Arg278insSerMetArgProGln' P0C7U7:p.Thr289_Gln290insGlnLeuLeuArgPro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain TQ TQLLRPQ Wed May 02 18:57:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr289thr_gln_leu_leu_arg_pro' Tue Jun 30 17:13:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr289_Gln290insGlnLeuLeuArgPro' P0C7U7:p.Ser292_Asp293insAspCysGlyArgThr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain SD SDCGRTD Wed May 02 16:31:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser292ser_asp_cys_gly_arg_thr' Wed Jun 13 17:28:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser292_Asp293insAspCysGlyArgThr' Tue Jun 30 18:20:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser292_Asp293insAspCysGlyArgThr' 3 unspecified role unspecified role prey prey physical association physical association Table 1 lcrv-lcrg-1 2 4 unspecified role unspecified role bait bait region P0C7U7-290-311 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P0C7U7:p.[Leu291Arg;Phe308Arg] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain F R Wed May 02 15:53:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu291arg,phe308arg' Tue Jun 30 19:48:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu291Arg;Phe308Arg]' 3 unspecified role unspecified role prey prey physical association physical association