IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Transgenic mouse proteomics identifies new 14-3-3-associated proteins involved in cytoskeletal rearrangements and cell signaling. Transgenic mouse proteomics identifies new 14-3-3-associated proteins involved in cytoskeletal rearrangements and cell signaling. Mol. Cell Proteomics (1535-9476) 2006 imex curation Angrand P.O., Segura I., Volkel P., Ghidelli S., Terry R., Brajenovic M., Vintersten K., Klein R., Superti-Furga G., Drewes G., Kuster B., Bouwmeester T., Acker-Palmer A. Results from Figure 5J (PAK-PBD pulldown assay) have not been included as the origin of PAK is not stated. Experiment 1:I can find no explanation for the differences in protein numbers/inclusion between Table 1 and Table S1, so I have acted on the assumption Table 1 might be some sort of "high confidence" dataset(??) (Proteins given in Table 1 are "selected" ....according to the authors...) PICR can only identify ~58 of proteins from Supplementary Table 1 - which corresponds to the number given in Table 1. Results have been entered from Table 1 rather than Table S1 as many identifiers from Table S1 cannot be found (presumed deprecated). Table 1 is also the selected set that authors have referenced in the publication. palmer@neuro.mpg.de, pierre-olivier.angrand@ibl.fr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Angrand P.O., Segura I., Volkel P., Ghidelli S., Terry R., Brajenovic M., Vintersten K., Klein R., Superti-Furga G., Drewes G., Kuster B., Bouwmeester T., Acker-Palmer A. This experiment relates to a negative interaction. Results from Figure 5J (PAK-PBD pulldown assay) have not been included as the origin of PAK is not stated. Experiment 1:I can find no explanation for the differences in protein numbers/inclusion between Table 1 and Table S1, so I have acted on the assumption Table 1 might be some sort of "high confidence" dataset(??) (Proteins given in Table 1 are "selected" ....according to the authors...) PICR can only identify ~58 of proteins from Supplementary Table 1 - which corresponds to the number given in Table 1. Results have been entered from Table 1 rather than Table S1 as many identifiers from Table S1 cannot be found (presumed deprecated). Table 1 is also the selected set that authors have referenced in the publication. palmer@neuro.mpg.de, pierre-olivier.angrand@ibl.fr Accepted 2012-SEP-13 by JYOTI 11-Oct-2012: Contacted by IntAct-Help. Mol. Cell Proteomics (1535-9476) 2006 Only protein-protein interactions imex curation snf5_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 SMARCB1 INI1 SNF5L1 Integrase interactor 1 protein BAF47 SNF5 homolog BRG1-associated factor 47 protein protein human Homo sapiens Human MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW B7BCA26875BD943D 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 ywhaz-ldb1-2 1 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role prey prey region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association true Fig 2E