UniProt UniProt http://www.uniprot.org Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation. Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation. Mol. Cell (1097-2765) 2005 imex curation Zhu B., Zheng Y., Pham A.D., Mandal S.S., Erdjument-Bromage H., Tempst P., Reinberg D. Nuclear extracts derived from a stable cell line expressing FLAG-RNF20 were subjected to affinity purification by using M2 anti-FLAG resin followed by Superose 6 gel filtration; bands were excised for MALDI-TOF mass spectrometry analyses. Ubiquitination assays (fig 2 A, B, C and 3G) not included as protein identities cannot be established (e.g. histone H2B). reinbed@umdnj.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu B., Zheng Y., Pham A.D., Mandal S.S., Erdjument-Bromage H., Tempst P., Reinberg D. Nuclear extracts derived from a stable cell line expressing FLAG-RNF20 were subjected to affinity purification by using M2 anti-FLAG resin followed by Superose 6 gel filtration; bands were excised for MALDI-TOF mass spectrometry analyses. Ubiquitination assays (fig 2 A, B, C and 3G) not included as protein identities cannot be established (e.g. histone H2B). reinbed@umdnj.edu Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 Only protein-protein interactions imex curation Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation. Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation. Mol. Cell (1097-2765) 2005 imex curation Zhu B., Zheng Y., Pham A.D., Mandal S.S., Erdjument-Bromage H., Tempst P., Reinberg D. Nuclear extracts derived from a stable cell line expressing FLAG-RNF20 were subjected to affinity purification by using M2 anti-FLAG resin followed by Superose 6 gel filtration; bands were excised for MALDI-TOF mass spectrometry analyses. Ubiquitination assays (fig 2 A, B, C and 3G) not included as protein identities cannot be established (e.g. histone H2B). reinbed@umdnj.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column ms participant Identification by mass spectrometry ms participant Zhu B., Zheng Y., Pham A.D., Mandal S.S., Erdjument-Bromage H., Tempst P., Reinberg D. Nuclear extracts derived from a stable cell line expressing FLAG-RNF20 were subjected to affinity purification by using M2 anti-FLAG resin followed by Superose 6 gel filtration; bands were excised for MALDI-TOF mass spectrometry analyses. Ubiquitination assays (fig 2 A, B, C and 3G) not included as protein identities cannot be established (e.g. histone H2B). reinbed@umdnj.edu Accepted 2012-APR-30 by JYOTI Mol. Cell (1097-2765) 2005 Only protein-protein interactions imex curation Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation. Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation. Mol. Cell (1097-2765) 2005 imex curation Zhu B., Zheng Y., Pham A.D., Mandal S.S., Erdjument-Bromage H., Tempst P., Reinberg D. Nuclear extracts derived from a stable cell line expressing FLAG-RNF20 were subjected to affinity purification by using M2 anti-FLAG resin followed by Superose 6 gel filtration; bands were excised for MALDI-TOF mass spectrometry analyses. Ubiquitination assays (fig 2 A, B, C and 3G) not included as protein identities cannot be established (e.g. histone H2B). reinbed@umdnj.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhu B., Zheng Y., Pham A.D., Mandal S.S., Erdjument-Bromage H., Tempst P., Reinberg D. Nuclear extracts derived from a stable cell line expressing FLAG-RNF20 were subjected to affinity purification by using M2 anti-FLAG resin followed by Superose 6 gel filtration; bands were excised for MALDI-TOF mass spectrometry analyses. Ubiquitination assays (fig 2 A, B, C and 3G) not included as protein identities cannot be established (e.g. histone H2B). reinbed@umdnj.edu Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 Only protein-protein interactions imex curation Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation. Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation. Mol. Cell (1097-2765) 2005 imex curation Zhu B., Zheng Y., Pham A.D., Mandal S.S., Erdjument-Bromage H., Tempst P., Reinberg D. Nuclear extracts derived from a stable cell line expressing FLAG-RNF20 were subjected to affinity purification by using M2 anti-FLAG resin followed by Superose 6 gel filtration; bands were excised for MALDI-TOF mass spectrometry analyses. Ubiquitination assays (fig 2 A, B, C and 3G) not included as protein identities cannot be established (e.g. histone H2B). reinbed@umdnj.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhu B., Zheng Y., Pham A.D., Mandal S.S., Erdjument-Bromage H., Tempst P., Reinberg D. Nuclear extracts derived from a stable cell line expressing FLAG-RNF20 were subjected to affinity purification by using M2 anti-FLAG resin followed by Superose 6 gel filtration; bands were excised for MALDI-TOF mass spectrometry analyses. Ubiquitination assays (fig 2 A, B, C and 3G) not included as protein identities cannot be established (e.g. histone H2B). reinbed@umdnj.edu Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 Only protein-protein interactions imex curation Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation. Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation. Mol. Cell (1097-2765) 2005 imex curation Zhu B., Zheng Y., Pham A.D., Mandal S.S., Erdjument-Bromage H., Tempst P., Reinberg D. Nuclear extracts derived from a stable cell line expressing FLAG-RNF20 were subjected to affinity purification by using M2 anti-FLAG resin followed by Superose 6 gel filtration; bands were excised for MALDI-TOF mass spectrometry analyses. Ubiquitination assays (fig 2 A, B, C and 3G) not included as protein identities cannot be established (e.g. histone H2B). reinbed@umdnj.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhu B., Zheng Y., Pham A.D., Mandal S.S., Erdjument-Bromage H., Tempst P., Reinberg D. Nuclear extracts derived from a stable cell line expressing FLAG-RNF20 were subjected to affinity purification by using M2 anti-FLAG resin followed by Superose 6 gel filtration; bands were excised for MALDI-TOF mass spectrometry analyses. Ubiquitination assays (fig 2 A, B, C and 3G) not included as protein identities cannot be established (e.g. histone H2B). reinbed@umdnj.edu Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 Only protein-protein interactions imex curation paf1_human RNA polymerase II-associated factor 1 homolog PAF1 PD2 Pancreatic differentiation protein 2 protein protein human Homo sapiens Human MAPTIQTQAQREDGHRPNSHRTLPERSGVVCRVKYCNSLPDIPFDPKFITYPFDQNRFVQYKATSLEKQHKHDLLTEPDLGVTIDLINPDTYRIDPNVLLDPADEKLLEEEIQAPTSSKRSQQHAKVVPWMRKTEYISTEFNRYGISNEKPEVKIGVSVKQQFTEEEIYKDRDSQITAIEKTFEDAQKSISQHYSKPRVTPVEVMPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVYDYKIAREYNWNVKNKASKGYEENYFFIFREGDGVYYNELETRVRLSKRRAKAGVQSGTNALLVVKHRDMNEKELEAQEARKAQLENHEPEEEEEEEMETEEKEAGGSDEEQEKGSSSEKEGSEDEHSGSESEREEGDRDEASDKSGSGEDESSEDEARAARDKEEIFGSDADSEDDADSDDEDRGQAQGGSDNDSDSGSNGGGQRSRSHSRSASPFPSGSEHSAQEDGSEAAASDSSEADSDSD DIP protein Q8N7H5 original sequence version: 43 DIP protein Q8N7H5 original sequence version: 100 756F800AA64255D6 ub2e1_human Ubiquitin-conjugating enzyme E2 E1 UBE2E1 UBCH6 Ubiquitin-protein ligase E1 Ubiquitin carrier protein E1 UbcH6 (E3-independent) E2 ubiquitin-conjugating enzyme E1 E2 ubiquitin-conjugating enzyme E1 protein protein human Homo sapiens Human MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT 2FBC50BE2A6A0008 ctr9_human RNA polymerase-associated protein CTR9 homolog CTR9 KIAA0155 SH2BP1 SH2 domain-binding protein 1 protein protein human Homo sapiens Human MSRGSIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDRAKAEAEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAHKGYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVVLYLARALFKCGKLQECKQTLLKARHVAPSDTVLMFNVALVLQRLATSVLKDEKSNLKEVLNAVKELELAHRYFSYLSKVGDKMRFDLALAATEARQCSDLLSQAQYHVARARKQDEEERELRAKQEQEKELLRQKLLKEQEEKRLREKEEQKKLLEQRAQYVEKTKNILMFTGETEATKEKKRGGGGGRRSKKGGEFDEFVNDDTDDDLPISKKKKRRKGSGSEQEGEDEEGGERKKKKRRRHPKGEEGSDDDETENGPKPKKRRPPKAEKKKAPKPERLPPSMKGKIKSKAIISSSDDSSDEDKLKIADEGHPRNSNSNSDSDEDEQRKKCASSESDSDENQNKSGSEAGSPRRPRRQRSDQDSDSDQPSRKRRPSGSEQSDNESVQSGRSHSGVSENDSRPASPSAESDHESERGSDNEGSGQGSGNESEPEGSNNEASDRGSEHGSDDSD DIP protein Q6PD62 original sequence version: 68 DIP protein Q6PD62 original sequence version: 122 4B5AC22A5C5573C6 bre1b_human E3 ubiquitin-protein ligase BRE1B 95 kDa retinoblastoma-associated protein RING finger protein 40 RNF40 BRE1B KIAA0661 RING-type E3 ubiquitin transferase BRE1B protein protein human Homo sapiens Human MSGPGNKRAAGDGGSGPPEKKLSREEKTTTTLIEPIRLGGISSTEEMDLKVLQFKNKKLAERLEQRQACEDELRERIEKLEKRQATDDATLLIVNRYWAQLDETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEMETTVEDLQWDIEKLRKREQKLNKHLAEALEQLNSGYYVSGSSSGFQGGQITLSMQKFEMLNAELEENQELANSRMAELEKLQAELQGAVRTNERLKVALRSLPEEVVRETGEYRMLQAQFSLLYNESLQVKTQLDEARGLLLATKNSHLRHIEHMESDELGLQKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQNLAANEQAGPINREMRHLISSLQNHNHQLKGDAQRYKRKLREVQAEIGKLRAQASGSAHSTPNLGHPEDSGVSAPAPGKEEGGPGPVSTPDNRKEMAPVPGTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELREREGPSLGPPPVASALSRADREKAKVEETKRKESELLKGLRAELKKAQESQKEMKLLLDMYKSAPKEQRDKVQLMAAERKAKAEVDELRSRIRELEERDRRESKKIADEDALRRIRQAEEQIEHLQRKLGATKQEEEALLSEMDVTGQAFEDMQEQNGRLLQQLREKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQVDAQLLTVQKLEEKERALQGSLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQTRLREIQPCLAESRAAREKESFNLKRAQEDISRLRRKLEKQRKVEVYADADEILQEEIKEYKARLTCPCCNTRKKDAVLTKCFHVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRIYIS 408A6E5A9CC25E41 bre1a_human E3 ubiquitin-protein ligase BRE1A RNF20 BRE1A RING finger protein 20 RING-type E3 ubiquitin transferase BRE1A protein protein human Homo sapiens Human MSGIGNKRAAGEPGTSMPPEKKAAVEDSGTTVETIKLGGVSSTEELDIRTLQTKNRKLAEMLDQRQAIEDELREHIEKLERRQATDDASLLIVNRYWSQFDENIRIILKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFSFLATLASSSSEEMESQLQERVESSRRAVSQIVTVYDKLQEKVELLSRKLNSGDNLIVEEAVQELNSFLAQENMRLQELTDLLQEKHRTMSQEFSKLQSKVETAESRVSVLESMIDDLQWDIDKIRKREQRLNRHLAEVLERVNSKGYKVYGAGSSLYGGTITINARKFEEMNAELEENKELAQNRLCELEKLRQDFEEVTTQNEKLKVELRSAVEQVVKETPEYRCMQSQFSVLYNESLQLKAHLDEARTLLHGTRGTHQHQVELIERDEVSLHKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQTLAANEQAGPINREMRHLISSLQNHNHQLKGEVLRYKRKLREAQSDLNKTRLRSGSALLQSQSSTEDPKDEPAELKPDSEDLSSQSSASKASQEDANEIKSKRDEEERERERREKEREREREREKEKEREREKQKLKESEKERDSAKDKEKGKHDDGRKKEAEIIKQLKIELKKAQESQKEMKLLLDMYRSAPKEQRDKVQLMAAEKKSKAELEDLRQRLKDLEDKEKKENKKMADEDALRKIRAVEEQIEYLQKKLAMAKQEEEALLSEMDVTGQAFEDMQEQNIRLMQQLREKDDANFKLMSERIKSNQIHKLLKEEKEELADQVLTLKTQVDAQLQVVRKLEEKEHLLQSNIGTGEKELGLRTQALEMNKRKAMEAAQLADDLKAQLELAQKKLHDFQDEIVENSVTKEKDMFNFKRAQEDISRLRRKLETTKKPDNVPKCDEILMEEIKDYKARLTCPCCNMRKKDAVLTKCFHVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYIG DIP protein Q5VTR2 original sequence version: 98 D75C7BE02880594A leo1_human RNA polymerase-associated protein LEO1 LEO1 RDL Replicative senescence down-regulated leo1-like protein protein protein human Homo sapiens Human MADMEDLFGSDADSEAERKDSDSGSDSDSDQENAASGSNASGSESDQDERGDSGQPSNKELFGDDSEDEGASHHSGSDNHSERSDNRSEASERSDHEDNDPSDVDQHSGSEAPNDDEDEGHRSDGGSHHSEAEGSEKAHSDDEKWGREDKSDQSDDEKIQNSDDEERAQGSDEDKLQNSDDDEKMQNTDDEERPQLSDDERQQLSEEEKANSDDERPVASDNDDEKQNSDDEEQPQLSDEEKMQNSDDERPQASDEEHRHSDDEEEQDHKSESARGSDSEDEVLRMKRKNAIASDSEADSDTEVPKDNSGTMDLFGGADDISSGSDGEDKPPTPGQPVDENGLPQDQQEEEPIPETRIEVEIPKVNTDLGNDLYFVKLPNFLSVEPRPFDPQYYEDEFEDEEMLDEEGRTRLKLKVENTIRWRIRRDEEGNEIKESNARIVKWSDGSMSLHLGNEVFDVYKAPLQGDHNHLFIRQGTGLQGQAVFKTKLTFRPHSTDSATHRKMTLSLADRCSKTQKIRILPMAGRDPECQRTEMIKKEEERLRASIRRESQQRRMREKQHQRGLSASYLEPDRYDEEEEGEESISLAAIKNRYKGGIREERARIYSSDSDEGSEEDKAQRLLKAKKLTSDEEGEPSGKRKAEDDDKANKKHKKYVISDEEEEDDD DIP protein Q8WVC0 original sequence version: 66 EB405BE0EDA7E0B0 rnf20-rnf40 2 10 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component physical association physical association 1E ube2e1-rnf20 5 7 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 2D rnf20-ube2e1 4 10 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 7 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2E ube2e1-ctr9 4 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey association association 3D paf1-ube2e1 1 7 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role bait bait direct interaction direct interaction 3E paf1-rnf20 3 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3E