mbinfo MBInfo http://www.mechanobio.info/ Interactions of WASp, myosin-I, and verprolin with Arp2/3 complex during actin patch assembly in fission yeast. Interactions of WASp, myosin-I, and verprolin with Arp2/3 complex during actin patch assembly in fission yeast. J. Cell Biol. (0021-9525) 2005 imex curation Sirotkin V., Beltzner C.C., Marchand J.B., Pollard T.D. The interaction between verprolin and G-actin in Fig 2D could not be curated since the organism source and the specific isoform of actin used was not identified. Arp2/3 complex isolated by affinity chromatography was further purified by ion exchange chromatography. The components were detected by coomassie staining and the identity of a subset of components was further confirmed by mass spectrometry. The source of the Arp2/3 complex components and of N-WASP specified by the author. thomas.pollard@yale.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Sirotkin V., Beltzner C.C., Marchand J.B., Pollard T.D. The interaction between verprolin and G-actin in Fig 2D could not be curated since the organism source and the specific isoform of actin used was not identified. Arp2/3 complex isolated by affinity chromatography was further purified by ion exchange chromatography. The components were detected by coomassie staining and the identity of a subset of components was further confirmed by mass spectrometry. The source of the Arp2/3 complex components and of N-WASP specified by the author. thomas.pollard@yale.edu Accepted 2012-AUG-02 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2005 Only protein-protein interactions imex curation Interactions of WASp, myosin-I, and verprolin with Arp2/3 complex during actin patch assembly in fission yeast. Interactions of WASp, myosin-I, and verprolin with Arp2/3 complex during actin patch assembly in fission yeast. J. Cell Biol. (0021-9525) 2005 imex curation Sirotkin V., Beltzner C.C., Marchand J.B., Pollard T.D. The interaction between verprolin and G-actin in Fig 2D could not be curated since the organism source and the specific isoform of actin used was not identified. Arp2/3 complex isolated by affinity chromatography was further purified by ion exchange chromatography. The components were detected by coomassie staining and the identity of a subset of components was further confirmed by mass spectrometry. The source of the Arp2/3 complex components and of N-WASP specified by the author. thomas.pollard@yale.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Sirotkin V., Beltzner C.C., Marchand J.B., Pollard T.D. The interaction between verprolin and G-actin in Fig 2D could not be curated since the organism source and the specific isoform of actin used was not identified. Arp2/3 complex isolated by affinity chromatography was further purified by ion exchange chromatography. The components were detected by coomassie staining and the identity of a subset of components was further confirmed by mass spectrometry. The source of the Arp2/3 complex components and of N-WASP specified by the author. thomas.pollard@yale.edu Accepted 2012-AUG-02 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2005 Only protein-protein interactions imex curation Interactions of WASp, myosin-I, and verprolin with Arp2/3 complex during actin patch assembly in fission yeast. Interactions of WASp, myosin-I, and verprolin with Arp2/3 complex during actin patch assembly in fission yeast. J. Cell Biol. (0021-9525) 2005 imex curation Sirotkin V., Beltzner C.C., Marchand J.B., Pollard T.D. The interaction between verprolin and G-actin in Fig 2D could not be curated since the organism source and the specific isoform of actin used was not identified. Arp2/3 complex isolated by affinity chromatography was further purified by ion exchange chromatography. The components were detected by coomassie staining and the identity of a subset of components was further confirmed by mass spectrometry. The source of the Arp2/3 complex components and of N-WASP specified by the author. thomas.pollard@yale.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Sirotkin V., Beltzner C.C., Marchand J.B., Pollard T.D. The interaction between verprolin and G-actin in Fig 2D could not be curated since the organism source and the specific isoform of actin used was not identified. Arp2/3 complex isolated by affinity chromatography was further purified by ion exchange chromatography. The components were detected by coomassie staining and the identity of a subset of components was further confirmed by mass spectrometry. The source of the Arp2/3 complex components and of N-WASP specified by the author. thomas.pollard@yale.edu Accepted 2012-AUG-02 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2005 Only protein-protein interactions imex curation arpc1_schpo Actin-related protein 2/3 complex subunit 1 arc1 SPBC14C8.06 Arp2/3 complex 41 kDa subunit p41-ARC sop2 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MATSQVLHILPKPSYEHAFNSQRTEFVTTTATNQVELYEQDGNGWKHARTFSDHDKIVTCVDWAPKSNRIVTCSQDRNAYVYEKRPDGTWKQTLVLLRLNRAATFVRWSPNEDKFAVGSGARVISVCYFEQENDWWVSKHLKRPLRSTILSLDWHPNNVLLAAGCADRKAYVLSAYVRDVDAKPEASVWGSRLPFNTVCAEYPSGGWVHAVGFSPSGNALAYAGHDSSVTIAYPSAPEQPPRALITVKLSQLPLRSLLWANESAIVAAGYNYSPILLQGNESGWAHTRDLDAGTSKTSFTHTGNTGEGREEEGPVSFTALRSTFRNMDLKGSSQSISSLPTVHQNMIATLRPYAGTPGNITAFTSSGTDGRVVLWTL C7016B4E6BEAA94D arpc5_schpo Actin-related protein 2/3 complex subunit 5 SPAC17G8.04c Arp2/3 complex 16 kDa subunit arc5 arc16 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTFRTLDVDSITEPVLTEQDIFPIRNETAEQVQAAVSQLIPQARSAIQTGNALQGLKTLLSYVPYGNDVQEVRTQYLNAFVDVLSNIRAADIPAFVKECSTEEIDNIVNFIYRGLANPQAYNSSVLLNWHEKVVEISGIGCIVRVLNSRPDL C892291720BA6161 arp2_schpo Actin-related protein 2 Actin-like protein 2 arp2 SPAC11H11.06 SPAC22F8.01 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDEAEAVRSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRKILLTEPPMNPVANREKMCETMFERYGFGGVYVAIQAVLSLYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLVGRLDVAGRDATRYLISLLLRKGYAFNRTADFETVREMKEKLCYVSYDLELDHKLSEETTVLMRNYTLPDGRVIKVGSERYECPECLFQPHLVGSEQPGLSEFIFDTIQAADVDIRKYLYRAIVLSGGSSMYAGLPSRLEKEIKQLWFERVLHGDPARLPNFKVKIEDAPRRRHAVFIGGAVLADIMAQNDHMWVSKAEWEEYGVRALDKLGPRTT D1439F6B49E4E306 myo1_schpo Myosin-1 myo1 SPBC146.13c Class I unconventional myosin Type I myosin protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAILKRTNRAKAATAAAPNSTGKSNGIKKAVYTSTRKKTVGVDDLTLLSKITDEEINKNLELRFRNGEIYTYIGHVLISVNPFRDLGIYTMDILKSYQGKNRLETSPHVYAIAENAYYQMKSYHENQCIIISGESGAGKTEAAKRIMQYITHVSKSVGTEIERVSEIILATNPLLESFGCAKTLRNNNSSRHGKYLEMIFNSGGVPVGAKITNYLLEKNRIVNQVRNERNFHIFYQFTKSAPQKYRDTYGIQGPENYVYTSACQCLSVDGISDEKDFQGTMNAMKVIGITEPEQDEIFRMLSIILWLGNIQFQEGQDGGSVISDKSITEFLGYLIGVPVAAIERALTIRIMQTQHGARRGSVYEVPLNPTQALAVRDALSMAIYNCLFDWIVERVNKALVTSDNSVSNSIGILDIYGFEIFENNSFEQLCINYVNEKLQQIFIELTLKTEQEEYVREQIAWTPIKYFNNKVVCDLIESKRPPGLFAAMNDAIATAHADSAAADSAFAQRLNFLSSNPHFEQRQNQFIVKHYAGDVTYSITGMTDKNKDQLATDILNLIHSSNNEFMKSIFPVAEESNSRRRPPTAGDRIKTSANDLVETLMKCQPSYIRTIKPNQTKSPNDYDQQMVLHQIKYLGLQENIRIRRAGFAYRQAFDTFAQRFAVLSGKTSYAGEYTWQGDDKSACEQILKDTNIPSSEYQMGTSKVFIKNPETLFALEDMRDKFWDTMATRIQRAWRSYVRRRSEAAACIQKLWNRNKVNMELERVRNEGTKLLQGKKQRRRYSILGSRKFYGDYLSASKPNGTLWNTCGLSQNDHVIFSMRCEVLVHKLGRTSKPSPRQLVLTKKNLYLVITKIVDQKLTQQVEKKFAVSSIDSVGLTNLQDDWVAIRNKSSQNGDMFLRCFFKTEFITTLKRINRNIQVIVGPTIQYCRKPGKVQTVKTAKDETTKDYDYYKSGTIHVGTGLPPTSKSKPFPRLATGGSTAAARGPRPVVQNKPAATKPVSMPAAKSKPAPMANPVSTAQQTQNRPPAPAMQARPNTTQAAAPVTSTTTTIKQATTVSASKPAPSTVTSAASSPSNISKPSAPVANNVSKPSAVPPPPPPPPAEVEKKDLYLALYDFAGRSPNEMTIKKDEIIEIVQKEPSGWWLALKNGAEGWVPATYVTEYKGSTPQTTASSTNVAAQANNNASPAEVNNLAGSLADALRMRASAVRGSDEEEDW 23851048FF5DEF0A wsp1_schpo Wiskott-Aldrich syndrome protein homolog 1 wsp1 SPAC4F10.15c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPPSSSITQEDKATIRKYIPKSTNKIIAAAVVKLYVAYPDPNKWNYTGLCGALVLSYDTTAKCCWFKLVDVVNNSGIIWDQELYQNMDYRQDRTFFHSFELDKCLAGFSFANETDAQKFYKKVLDKGCHPESIENPVLSFITRKGSSRHAPNNSNIQPPSAAPPVPGKENYNAVGSKSPNEPELLNSLDPSLIDSLMKMGISQDQIAENADFVKAYLNESAGTPTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAPVASIAELPQQDGRANLMASIRASGGMDLLKSRKVSASPSVASTKTSNPPVEAPPSNNLMDALASALNQRKTKVAQSDEEDEDDDEWD C6E5EFCA6A02F0E4 vrp1_schpo Verprolin SPBC13E7.09 vrp1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAPAPPPPPPAPAPAAAAPAPPLMTGDRSALLNSIQKGKKLKKATTNDRSAPVVGGGVVGERKSNTPKSFAAPPVPTGAPSLPTSSNNTQQAEERPSMPALGGLFAGGMPKLRHIGKSSASAAPPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPKFPNRGPSIPSASVPPVPPSSYVLQQRPNRVDDHGRFHFKDDSYLPIPHPFLGVPKVYRGGSGTTVPLNLSSF 47B68086BD93B7D5 arpc3_schpo Actin-related protein 2/3 complex subunit 3 SPBC1778.08c Arp2/3 complex 21 kDa subunit arc3 arc21 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPAYHSSFLSLTDVPTTGNIAMLPLKTKFRGPAYPADESQMDIIDECIGLFRANCFFRNFEIKGPADRTLIYGTLFISECLGRVNGLNYRDAERQLNSLALENFSIPGSAGFPLNALYAPPLSPQDAEIMRTYLTQFRQELAYRLLSHVYATEKDHPSKWWTCFSKRRFMNKAL 0948C5EF7089CB79 arp3_schpo Actin-related protein 3 act2 SPAC630.03 Actin-like protein 3 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MASFNVPIIMDNGTGYSKLGYAGNDAPSYVFPTVIATRSAGASSGPAVSSKPSYMASKGSGHLSSKRATEDLDFFIGNDALKKASAGYSLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVVDSGDGVTHIIPVAEGYVIGSSIKTMPLAGRDVTYFVQSLLRDRNEPDSSLKTAERIKEECCYVCPDIVKEFSRFDREPDRYLKYASESITGHSTTIDVGFERFLAPEIFFNPEIASSDFLTPLPELVDNVVQSSPIDVRKGLYKNIVLSGGSTLFKNFGNRLQRDLKRIVDERIHRSEMLSGAKSGGVDVNVISHKRQRNAVWFGGSLLAQTPEFGSYCHTKADYEEYGASIARRYQIFGNSL C7909FFEE544789B arpc4_schpo Actin-related protein 2/3 complex subunit 4 arc4 SPAC6G9.07c Arp2/3 complex 20 kDa arp20 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSNTLRPYLNAVRSTLTASLALEEFSSEIVERQSQPEVEVGRSPEILLKPLVVSRNEQEQCLIESSVNSVRFSIRIKQVDEIERILVRKFMQFLMGRAESFFILRRKPVQGYDISFLITNYHTEEMLKHKLVDFIIEFMEEVDAEISEMKLFLNGRARLVAETYLSCF 93E7D63F3907820E arpc2_schpo Actin-related protein 2/3 complex subunit 2 SPAC6F6.10c Arp2/3 complex 34 kDa subunit arc2 arc34 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLSLDYNNIFIYELLTERFSSENPSSIDQVVTDFDGVTFHISTPEEKTKILISLSMKCYPELVNYGTLDLLKQIYGAYVHEPEMGYNFSILIDLQQLPATDEEKEQLAMSISMLKRNVLAAPFHRAFTKQAELADLARKDPENAPMLDKQATSQELMAIHYRDEETIVLWPEHDRVTVVFSTKFREETDRIFGKVFLQEFVDARRRPAIQTAPQVLFSYRDPPLEIRDIQGIQKGDDFGFVTFVLFERHFTPQNREDCISHIQVFRNTLHFHIKASKAYMHQRMRKRVADFQKVLNRAKPDVELERKTATGRSFVRA 2B1FD6B3498F0C2A act2-arc1 1 10 unspecified role unspecified role unspecified role unspecified role 13 unspecified role unspecified role unspecified role unspecified role 6 unspecified role unspecified role unspecified role unspecified role 5 unspecified role unspecified role unspecified role unspecified role 4 unspecified role unspecified role unspecified role unspecified role 11 unspecified role unspecified role unspecified role unspecified role 12 unspecified role unspecified role unspecified role unspecified role association association Fig 1C. act2-arc1-1 2 7 unspecified role unspecified role bait bait n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range acidic domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain The sequence range of the acidic domain was taken from previous references of the contributing author [PMID: 11076964]. ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 5 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 12 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 13 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 11 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 4 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 10 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast association association Fig 2A. act2-arc1-2 2 8 unspecified role unspecified role bait bait vca region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 6 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 11 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 4 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 13 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 5 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast 12 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast association association Fig 2B. myo1-vrp1 2 7 unspecified role unspecified role bait bait n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain The sequence range of the SH3 domain taken from previous references of the contributing author [PMID:11076964]. ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey c-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 2C, Table 1. myo1-wsp1-4 3 7 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 5A, Suppl. Table 2. vrp1-wsp1-3 3 9 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 5B, Suppl. Table 2. arc5-wsp1 3 8 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 5D, Suppl. Table 2. arc5-myo1 3 7 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 5C, Suppl. Table 2. arc5-myo1-1 3 7 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Suppl. Table 2. arc5-wsp1-1 3 8 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Suppl. Table 2. arc5-vrp1 3 9 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Suppl. Table 2. myo1-wsp1-6 3 7 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Suppl. Table 2. myo1-vrp1-3 3 7 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Suppl. Table 2.