IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. Oncogene (0950-9232) 2004 imex curation Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Accepted 2012-NOV-01 by MGT 15-Nov-2012: Contacted by pporras. Human brain cDNA library. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. Oncogene (0950-9232) 2004 imex curation Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro protein array protein array predetermined predetermined participant predetermined Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Accepted 2012-NOV-01 by MGT 15-Nov-2012: Contacted by pporras. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. Oncogene (0950-9232) 2004 imex curation Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting tag visualisation tag visualisation Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Accepted 2012-NOV-01 by MGT 15-Nov-2012: Contacted by pporras. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. Oncogene (0950-9232) 2004 imex curation Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Accepted 2012-NOV-01 by MGT 15-Nov-2012: Contacted by pporras. Human brain cDNA library. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. Oncogene (0950-9232) 2004 imex curation Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Accepted 2012-NOV-01 by MGT 15-Nov-2012: Contacted by pporras. Human brain cDNA library. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. Oncogene (0950-9232) 2004 imex curation Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Accepted 2012-NOV-01 by MGT 15-Nov-2012: Contacted by pporras. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation wbp1 WBP1 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SGSGGTPPPPYTVG Similar to P97764 aas 170-179 f189b_human Protein FAM189B FAM189B C1orf2 COTE1 Protein COTE1 protein protein human Homo sapiens Human MMPSPSDSSRSLTSRPSTRGLTHLRLHRPWLQALLTLGLVQVLLGILVVTFSMVASSVTTTESIKRSCPSWAGFSLAFSGVVGIVSWKRPFTLVISFFSLLSVLCVMLSMAGSVLSCKNAQLARDFQQCSLEGKVCVCCPSVPLLRPCPESGQELKVAPNSTCDEARGALKNLLFSVCGLTICAAIICTLSAIVCCIQIFSLDLVHTLAPERSVSGPLGPLGCTSPPPAPLLHTMLDLEEFVPPVPPPPYYPPEYTCSSETDAQSITYNGSMDSPVPLYPTDCPPSYEAVMGLRGDSQATLFDPQLHDGSCICERVASIVDVSMDSGSLVLSAIGDLPGGSSPSEDSCLLELQGSVRSVDYVLFRSIQRSRAGYCLSLDCGLRGPFEESPLPRRPPRAARSYSCSAPEAPPPLGAPTAARSCHRLEGWPPWVGPCFPELRRRVPRGGGRPAAAPPTRAPTRRFSDSSGSLTPPGHRPPHPASPPPLLLPRSHSDPGITTSSDTADFRDLYTKVLEEEAASVSSADTGLCSEACLFRLARCPSPKLLRARSAEKRRPVPTFQKVPLPSGPAPAHSLGDLKGSWPGRGLVTRFLQISRKAPDPSGTGAHGHKQVPRSLWGRPGRESLHLRSCGDLSSSSSLRRLLSGRRLERGTRPHSLSLNGGSRETGL E22EED90923826BD wbp1_human WW domain-binding protein 1 WBP1 protein protein human Homo sapiens Human MARASSGNGSEEAWGALRAPQQQLRELCPGVNNQPYLCESGHCCGETGCCTYYYELWWFWLLWTVLILFSCCCAFRHRRAKLRLQQQQRQREINLLAYHGACHGAGPFPTGSLLDLRFLSTFKPPAYEDVVHRPGTPPPPYTVAPGRPLTASSEQTCCSSSSSCPAHFEGTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP 009CF5A444E62AC0 litaf_human Lipopolysaccharide-induced tumor necrosis factor-alpha factor p53-induced gene 7 protein Small integral membrane protein of lysosome/late endosome LITAF PIG7 SIMPLE protein protein human Homo sapiens Human MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL 08D15BF1FDCA16F0 shsa5_human Protein shisa-5 SHISA5 SCOTIN Scotin Putative NF-kappa-B-activating protein 120 PSEC0133 protein protein human Homo sapiens Human MTAPVPAPRILLPLLLLLLLTPPPGARGEVCMASRGLSLFPESCPDFCCGTCDDQYCCSDVLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL 7C4A8E7A2AD8E272 wwox_human WW domain-containing oxidoreductase WWOX FOR WOX1 Fragile site FRA16D oxidoreductase SDR41C1 Short chain dehydrogenase/reductase family 41C member 1 protein protein human Homo sapiens Human MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG E4D9A649E6CB05DF wbp1-wwox 3 12 unspecified role unspecified role prey prey purified purified ww 1 domain-containing region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1b wwox-fam189b 2 12 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2a wwox-litaf 2 10 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait purified purified ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2a wwox-wbp1 2 9 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 2a wwox-shsa5 2 11 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait purified purified ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2a wwox-wbp1-1 5 12 unspecified role unspecified role bait bait purified purified ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2b wwox-fam189b-1 5 8 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait purified purified ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2b wwox-litaf-1 5 12 unspecified role unspecified role bait bait purified purified ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2b wwox-shsa5-1 5 12 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2b wwox-wbp1-2 1 12 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey cell lysate cell lysate Q96G27:p.Tyr141Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:31:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr141ala' Tue Jun 30 18:18:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr141Ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 3a wwox-litaf-2 1 10 unspecified role unspecified role prey prey cell lysate cell lysate Q99732:p.[Tyr23Ala;Tyr61Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A Fri Jul 22 11:09:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr61ala,tyr23ala' Wed May 02 17:09:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr23ala,tyr61ala' Tue Jun 30 20:03:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr23Ala;Tyr61Ala]' Q99732:p.Tyr23Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:30:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr23ala' Tue Jun 30 16:55:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr23Ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 3A wwox-litaf-3 4 12 unspecified role unspecified role bait bait purified purified Q9NZC7:p.[Tyr85Ala;Pro88Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain Y A Fri Jul 22 10:55:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro88ala,tyr85ala' Wed May 02 19:57:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr85ala,pro88ala' Tue Jun 30 19:26:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr85Ala;Pro88Ala]' ww 1 domain-containing region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9NZC7:p.[Trp44Phe;Pro47Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W F certain certain sequence position certain certain certain sequence position certain P A Wed May 02 14:52:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp44phe,pro47ala' Tue Jun 30 19:02:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp44Phe;Pro47Ala]' n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey cell lysate cell lysate human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells physical association physical association 3b litaf-wwox 6 12 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 4i