UniProt UniProt http://www.uniprot.org ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. Nat. Cell Biol. (1465-7392) 2004 mimix curation Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy immunostaining immunostaining Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Accepted 2012-SEP-12 by JYOTI 11-Oct-2012: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2004 mimix curation ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. Nat. Cell Biol. (1465-7392) 2004 mimix curation Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Accepted 2012-SEP-12 by JYOTI 11-Oct-2012: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2004 mimix curation ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. Nat. Cell Biol. (1465-7392) 2004 mimix curation Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Accepted 2012-SEP-12 by JYOTI 11-Oct-2012: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2004 mimix curation ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. Nat. Cell Biol. (1465-7392) 2004 mimix curation Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Accepted 2012-SEP-12 by JYOTI 11-Oct-2012: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2004 mimix curation ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. Nat. Cell Biol. (1465-7392) 2004 mimix curation Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Accepted 2012-SEP-12 by JYOTI 11-Oct-2012: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2004 mimix curation ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. Nat. Cell Biol. (1465-7392) 2004 mimix curation Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Accepted 2012-SEP-12 by JYOTI 11-Oct-2012: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2004 mimix curation ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. Nat. Cell Biol. (1465-7392) 2004 mimix curation Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Accepted 2012-SEP-12 by JYOTI 11-Oct-2012: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2004 mimix curation asc_human Apoptosis-associated speck-like protein containing a CARD PYD and CARD domain-containing protein Target of methylation-induced silencing 1 Caspase recruitment domain-containing protein 5 ASC CARD5 TMS1 PYCARD protein protein human Homo sapiens Human MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS DIP protein Q9ULZ3 original sequence version: 116 455987286586F46A bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 pycard-bax 3 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 4a bax-pycard 4 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 4a bax-pycard-1 5 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 4a pycard-bax-1 7 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 4a bax-pycard-2 6 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 4a bax-pycard-4 2 9 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection 8 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection physical association physical association 4b bax-pycard-5 1 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association 4b