UniProt UniProt http://www.uniprot.org Dab2 links CIN85 with clathrin-mediated receptor internalization. Dab2 links CIN85 with clathrin-mediated receptor internalization. FEBS Lett. (0014-5793) 2003 imex curation Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de Accepted 2012-OCT-01 by MGT 11-Oct-2012: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation Dab2 links CIN85 with clathrin-mediated receptor internalization. Dab2 links CIN85 with clathrin-mediated receptor internalization. FEBS Lett. (0014-5793) 2003 imex curation Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de Accepted 2012-OCT-01 by MGT 11-Oct-2012: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation Dab2 links CIN85 with clathrin-mediated receptor internalization. Dab2 links CIN85 with clathrin-mediated receptor internalization. FEBS Lett. (0014-5793) 2003 imex curation Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de Accepted 2012-OCT-01 by MGT 11-Oct-2012: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation Dab2 links CIN85 with clathrin-mediated receptor internalization. Dab2 links CIN85 with clathrin-mediated receptor internalization. FEBS Lett. (0014-5793) 2003 imex curation Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de Accepted 2012-OCT-01 by MGT 11-Oct-2012: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation Dab2 links CIN85 with clathrin-mediated receptor internalization. Dab2 links CIN85 with clathrin-mediated receptor internalization. FEBS Lett. (0014-5793) 2003 imex curation Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de Accepted 2012-OCT-01 by MGT 11-Oct-2012: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation Dab2 links CIN85 with clathrin-mediated receptor internalization. Dab2 links CIN85 with clathrin-mediated receptor internalization. FEBS Lett. (0014-5793) 2003 imex curation Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de Accepted 2012-OCT-01 by MGT 11-Oct-2012: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation Dab2 links CIN85 with clathrin-mediated receptor internalization. Dab2 links CIN85 with clathrin-mediated receptor internalization. FEBS Lett. (0014-5793) 2003 imex curation Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de Accepted 2012-OCT-01 by MGT 11-Oct-2012: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation Dab2 links CIN85 with clathrin-mediated receptor internalization. Dab2 links CIN85 with clathrin-mediated receptor internalization. FEBS Lett. (0014-5793) 2003 imex curation Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-nih_saa Mus musculus NIH SAA cells nih_saa NIH SAA cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kowanetz K., Terzic J., Dikic I. Origin of Dab2 constructs according P.H.Howe, who worked with mouse (eg pmid 12805222), mentioned purified mouse peptide and position indication of mutant relative to human protein. Origin of Dab1 construct according pmid 9716537. Purified c-Cbl peptide sequence (fig 2A) annotated as of mouse origin (identical with human in this range). Binding sites for SH3KBP1/CIN85 according pmid 12874286 and pmid 10679202. ivan.dikic@biochem2.de Accepted 2012-OCT-01 by MGT 11-Oct-2012: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation dab1_mouse Disabled homolog 1 Dab1 protein protein mouse Mus musculus Mouse MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPNSQPLEDFESRFAAATPNRNLSMDFDELLEATKVSAVTQLELFGDMSTPPDITSPPTPATPGDAFLPSSSQTLPGSADVFGSMSFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQIAMGAQPPVAQVIPGAQPIAWGQPGLFPATQQAWPTVAGQFPPAAFMPTQTVMPLAAAMFQGPLTPLATVPGTNDSARSSPQSDKPRQKMGKESFKDFQMVQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHVSDPTADDIFEEGFESPSKSEEQEAPDGSQASSTSDPFGEPSGEPSGDNISPQDGS DIP protein P97318 original sequence version: 94 08404220792B1DB4 sh3k1_mouse SH3 domain-containing kinase-binding protein 1 SH3-containing, expressed in tumorigenic astrocytes Regulator of ubiquitous kinase Sh3kbp1 Ruk Seta protein protein mouse Mus musculus Mouse MVEAIVEFDYQAQHDDELTISVGEVITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKDMKKDLLSNKAPEKPMHDVSSGNALLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSRPEGFLPASLLPFPAHGAKGKTTFEGTILYRAAPGKTEGHRRYYSLRETTGSESDGGDSSSTKSEGANGTMATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPPATSTPDPSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPSDFDKEGNRPKKPPPPSAPVVKQGAGTTERKHEIKKIPPERPETLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLNRPGALPPRRPERPVGPLTHTRGDSPKIDLAGSALSGILDKDLSDRSNDIDLEGFDSVISSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSKTVTISQVSDNKTSLPPKPGTMAAASSGPASLSSVASSPMSSSLGTAGQRASSPSLFSTEGKPKMEPAVSSQAAIEELKMQVRELRTIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK AC2DDFB3248A458B dab2_human Disabled homolog 2 DAB2 DOC2 Differentially-expressed protein 2 Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 protein protein human Homo sapiens Human MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILDDQTNKLKSGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSVQSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTSAPAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSPFAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFPAPAVSTQPPSMHSSLLVTPPQPPPRAGPPKDISSDAFTALDPLGDKEIKDVKEMFKDFQLRQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA 5B2F8B510A580A77 clh1_human Clathrin heavy chain 1 Clathrin heavy chain on chromosome 17 CLTC CLH17 KIAA0034 CLTCL2 protein protein human Homo sapiens Human MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM 6C4F2D54950079E2 cbl_human E3 ubiquitin-protein ligase CBL Signal transduction protein CBL Proto-oncogene c-Cbl Casitas B-lineage lymphoma proto-oncogene RING finger protein 55 CBL CBL2 RNF55 RING-type E3 ubiquitin transferase CBL protein protein human Homo sapiens Human MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVERPPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLRDLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPVSAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECDHPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRACDCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVAT DIP protein P22681 original sequence version: 173 DIP protein P22681 original sequence version: 128 DIP protein P22681 original sequence version: 145 DIP protein P22681 original sequence version: 150 DIP protein P22681 original sequence version: 191 DIP protein P22681 original sequence version: 91 DIP protein P22681 original sequence version: 139 1AA6BF67377322CA clh1_mouse Clathrin heavy chain 1 Cltc protein protein mouse Mus musculus Mouse MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANASGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVELYYKAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM DIP protein Q68FD5 original sequence version: 84 6C41EBD89EB7D56B dab2_mouse Disabled homolog 2 Mitogen-responsive phosphoprotein Dab2 Doc2 Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 protein protein mouse Mus musculus Mouse MSNEVETSTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKKVEEANKAEENGSEALMTLDDQANKLKLGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGVTSCSLPRPKPQASFLPENAFSANLNFFPTPNPDPFRDDPFAQPDQSAPSSFDSLTSPDQKKASLSSSSTPQSKGPLNGDTDYFGQQFDQLSNRTGKPEAQGGPWPYPSSQTQQAVRTQNGVSEREQNGFHIKSSPNPFVGSPPKGLSVPNGVKQDLESSVQSSAHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFASEPPGQMSPTGQPAVPQSNFLDLFKGNAPAPVGPLVGLGTVPVTPPQAGPWTPVVYSPSTTVVPGAIISGQPPSFRQPLVFGTTPAVQVWNQSPSFATPASPPPPTVWCPTTSVAPNAWSSTSPLGNPFQSNNIFPPPTMSTQSSPQPMMSSVLATPPQPPPRNGPLKDIPSDAFTGLDPLGDKEVKEVKEMFKDFQLRQPPLVPSRKGETPPSGTSSAFSSYFNNKVGIPQEHVDHDDFDANQLLNKINEPPKPAPRQGVLLGTKSADNSLENPFSKGFSSSNPSVVSQPASSDPHRSPFGNPFA DIP protein P98078 original sequence version: 127 856C946BD43C4B07 sh3k1_human SH3 domain-containing kinase-binding protein 1 SH3KBP1 CIN85 Cbl-interacting protein of 85 kDa Human Src family kinase-binding protein 1 CD2-binding protein 3 protein protein human Homo sapiens Human MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHEIKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPRRPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKMEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK 3BD350FCDB14BD4C sh3kbp1-dab2 4 11 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association no figure sh3kbp1-dab2-1 3 11 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait sh3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A sh3kbp1-dab2-2 1 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 1B and C sh3kbp1-dab1 1 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 1B dab2-sh3kbp1 7 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 16 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 2A cbl-sh3kbp1-5 7 16 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 2A sh3kbp1-dab2-3 2 15 unspecified role unspecified role prey prey cell lysate cell lysate P98078:p.Arg718Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:20:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg718ala' Tue Jun 30 19:33:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg718Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 16 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2B sh3kbp1-dab2-4 5 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection P98078:p.Arg718Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:26:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg718ala' Tue Jun 30 17:36:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg718Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association 2C and 4A/C EGF stimulation c-Cb1 peptide SQVPERPPKFPRRINSE (corresponds to human CBL UniProt P22681 aa 817-834). Binding between CIN85 and Dab2 was observed in unstimulated cells, was significantly decreased after 2 min of EGF stimulation, and completely undetectable after 20 min. sh3kbp1-cltc 2 15 unspecified role unspecified role prey prey cell lysate cell lysate mouse-nih_saa Mus musculus NIH SAA cells nih_saa NIH SAA cells 14 unspecified role unspecified role prey prey cell lysate cell lysate mouse-nih_saa Mus musculus NIH SAA cells nih_saa NIH SAA cells 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association 3A EGF stimulation sh3kbp1-cltc-1 2 15 unspecified role unspecified role prey prey cell lysate cell lysate P98078:p.Arg718Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:36:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg718ala' Tue Jun 30 15:39:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg718Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 12 unspecified role unspecified role prey prey cell lysate cell lysate human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association 3B dab2-sh3kbp1-1 6 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P98078:p.Arg718Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 17:48:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg718ala' Tue Jun 30 17:32:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg718Ala' 16 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 2C and 4A EGF stimulation sh3kbp1-dab2-5 8 15 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 4B EGF stimulation sh3kbp1-dab2-6 1 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 16 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 4D c-Cb1 peptide SQVPERPPKFPRRINSE (corresponds to human CBL UniProt P22681 aa 817-834). A mutant peptide with arg829ala does not change the interaction. sh3kbp1-cbl-1 5 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 16 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection association association 4E EGF stimulation c-Cb1 peptide SQVPERPPKFPRRINSE (corresponds to human CBL UniProt P22681 aa 817-834). A mutant peptide with arg829ala does not change the interaction. EGF stimulation reduces assocation of DAB2 and has no effect on association of CBL. Transfecting CBL with a arg829ala mutation impairs association of CBL and enhances association of DAB2, irrespectively of EGF stimulation.