UniProt UniProt http://www.uniprot.org The apoptosis-inducing protein kinase DRAK2 is inhibited in a calcium-dependent manner by the calcium-binding protein CHP. The apoptosis-inducing protein kinase DRAK2 is inhibited in a calcium-dependent manner by the calcium-binding protein CHP. J. Biochem. (0021-924X) 2003 imex curation Kuwahara H., Kamei J., Nakamura N., Matsumoto M., Inoue H., Kanazawa H. The in vitro kinase assay in figures 1, 2 and 3 uses the substrate myosin light chain of bovine (Sigma), but it is not possible to know to which isoform it correspond. nnakamur@bio.sci.osaka-u.ac.jp Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kuwahara H., Kamei J., Nakamura N., Matsumoto M., Inoue H., Kanazawa H. The in vitro kinase assay in figures 1, 2 and 3 uses the substrate myosin light chain of bovine (Sigma), but it is not possible to know to which isoform it correspond. nnakamur@bio.sci.osaka-u.ac.jp Accepted 2012-JUN-21 by ORCHARD J. Biochem. (0021-924X) 2003 Only protein-protein interactions imex curation The apoptosis-inducing protein kinase DRAK2 is inhibited in a calcium-dependent manner by the calcium-binding protein CHP. The apoptosis-inducing protein kinase DRAK2 is inhibited in a calcium-dependent manner by the calcium-binding protein CHP. J. Biochem. (0021-924X) 2003 imex curation Kuwahara H., Kamei J., Nakamura N., Matsumoto M., Inoue H., Kanazawa H. The in vitro kinase assay in figures 1, 2 and 3 uses the substrate myosin light chain of bovine (Sigma), but it is not possible to know to which isoform it correspond. nnakamur@bio.sci.osaka-u.ac.jp Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Kuwahara H., Kamei J., Nakamura N., Matsumoto M., Inoue H., Kanazawa H. The in vitro kinase assay in figures 1, 2 and 3 uses the substrate myosin light chain of bovine (Sigma), but it is not possible to know to which isoform it correspond. nnakamur@bio.sci.osaka-u.ac.jp Accepted 2012-JUN-21 by ORCHARD J. Biochem. (0021-924X) 2003 Only protein-protein interactions imex curation st17b_rat Serine/threonine-protein kinase 17B Stk17b Drak2 DAP kinase-related apoptosis-inducing protein kinase 2 protein protein rat Rattus norvegicus (Rat) Rat MSRRRFDCRSISGLLTTTPQTPMKTENFNNFYTLTPKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELARSCPHVINLHEVYETATEIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQQWDFGSLFHPEETSESSQTQDLSLRSSEDKTPKSCNGSCGDREDKENIPEDDSLLSKRFRFDDSLPSPHELVPDLFC 7BD4E83D98896F4F chp1_rat Calcineurin B homologous protein 1 Chp1 Calcineurin B-like protein Calcium-binding protein CHP Calcium-binding protein p22 Chp EF-hand calcium-binding domain-containing protein p22 protein protein rat Rattus norvegicus (Rat) Rat MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH 7B803EF0ABED829E stk17b-chp 1 4 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 stk17b-1 2 3 putative self putative self putative self putative self region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation true 1 chp-stk17b-8 2 4 inhibitor inhibitor unspecified role unspecified role 3 putative self putative self putative self putative self purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2, 3 and 4