UniProt UniProt http://www.uniprot.org The A20-binding protein ABIN-2 exerts unexpected function in mediating transcriptional coactivation. The A20-binding protein ABIN-2 exerts unexpected function in mediating transcriptional coactivation. FEBS Lett. (0014-5793) 2003 imex curation Chien C.Y., Liu W.K., Chou C.K., Su J.Y. jysu@ym.edu.tw hepatoma cell line Huh7 cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chien C.Y., Liu W.K., Chou C.K., Su J.Y. jysu@ym.edu.tw Accepted 2012-JUL-09 by PPORRAS hepatoma cell line Huh7 cDNA FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation The A20-binding protein ABIN-2 exerts unexpected function in mediating transcriptional coactivation. The A20-binding protein ABIN-2 exerts unexpected function in mediating transcriptional coactivation. FEBS Lett. (0014-5793) 2003 imex curation Chien C.Y., Liu W.K., Chou C.K., Su J.Y. jysu@ym.edu.tw hepatoma cell line Huh7 cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chien C.Y., Liu W.K., Chou C.K., Su J.Y. jysu@ym.edu.tw Accepted 2012-JUL-09 by PPORRAS hepatoma cell line Huh7 cDNA FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation stk11_human Serine/threonine-protein kinase STK11 STK11 LKB1 PJS Liver kinase B1 Renal carcinoma antigen NY-REN-19 protein protein human Homo sapiens Human MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ DIP protein Q15831 original sequence version: 117 DIP protein Q15831 original sequence version: 154 DIP protein Q15831 original sequence version: 174 DIP protein Q15831 original sequence version: 168 6DF4C37AB7A89569 smrd1_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 SMARCD1 BAF60A SWI/SNF complex 60 kDa subunit 60 kDa BRG-1/Brm-associated factor subunit A BRG1-associated factor 60A protein protein human Homo sapiens Human MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT DIP protein Q96GM5 original sequence version: null DIP protein Q96GM5 original sequence version: 75 E683AA1E345DA400 tnip2_human TNFAIP3-interacting protein 2 TNIP2 ABIN2 FLIP1 Fetal liver LKB1-interacting protein A20-binding inhibitor of NF-kappa-B activation 2 protein protein human Homo sapiens Human MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAAPSLVDALLEQVARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHEREKEVVLLRRSMAEGERARAASDVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEENRLLKQKVTHVEDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSDEQGEELLRHVAECCQ 0F6B049C2B3483DC tnip2-smarcd1 1 5 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association no figure tnip2-smarcd1-1 2 4 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 4A and B stk11-tnip2-5 2 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Table 1