UniProt UniProt http://www.uniprot.org Human MI-ER1 alpha and beta function as transcriptional repressors by recruitment of histone deacetylase 1 to their conserved ELM2 domain. Human MI-ER1 alpha and beta function as transcriptional repressors by recruitment of histone deacetylase 1 to their conserved ELM2 domain. Mol. Cell. Biol. (0270-7306) 2003 mimix curation Ding Z., Gillespie L.L., Paterno G.D. gpaterno@mun.ca 19-Jun-2012: Contacted by JYOTI. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ding Z., Gillespie L.L., Paterno G.D. gpaterno@mun.ca Accepted 2012-FEB-27 by JYOTI 19-Jun-2012: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2003 mimix curation Human MI-ER1 alpha and beta function as transcriptional repressors by recruitment of histone deacetylase 1 to their conserved ELM2 domain. Human MI-ER1 alpha and beta function as transcriptional repressors by recruitment of histone deacetylase 1 to their conserved ELM2 domain. Mol. Cell. Biol. (0270-7306) 2003 mimix curation Ding Z., Gillespie L.L., Paterno G.D. gpaterno@mun.ca 19-Jun-2012: Contacted by JYOTI. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ding Z., Gillespie L.L., Paterno G.D. gpaterno@mun.ca Accepted 2012-FEB-27 by JYOTI Mol. Cell. Biol. (0270-7306) 2003 mimix curation Human MI-ER1 alpha and beta function as transcriptional repressors by recruitment of histone deacetylase 1 to their conserved ELM2 domain. Human MI-ER1 alpha and beta function as transcriptional repressors by recruitment of histone deacetylase 1 to their conserved ELM2 domain. Mol. Cell. Biol. (0270-7306) 2003 mimix curation Ding Z., Gillespie L.L., Paterno G.D. gpaterno@mun.ca 19-Jun-2012: Contacted by JYOTI. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ding Z., Gillespie L.L., Paterno G.D. gpaterno@mun.ca Accepted 2012-FEB-27 by JYOTI 19-Jun-2012: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2003 mimix curation Human MI-ER1 alpha and beta function as transcriptional repressors by recruitment of histone deacetylase 1 to their conserved ELM2 domain. Human MI-ER1 alpha and beta function as transcriptional repressors by recruitment of histone deacetylase 1 to their conserved ELM2 domain. Mol. Cell. Biol. (0270-7306) 2003 mimix curation Ding Z., Gillespie L.L., Paterno G.D. gpaterno@mun.ca 19-Jun-2012: Contacted by JYOTI. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ding Z., Gillespie L.L., Paterno G.D. gpaterno@mun.ca Accepted 2012-FEB-27 by JYOTI 19-Jun-2012: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2003 mimix curation hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 mier1_human Mesoderm induction early response protein 1 MIER1 KIAA1610 protein protein human Homo sapiens Human MAEPSVESSSPGGSATSDDHEFDPSADMLVHDFDDERTLEEEEMMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRYKENEKVYENDDQLLWDPEYLPEDKVIIFLKDASRRTGDEKGVEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRFNVKAAREELSVWTEEECRNFEQGLKAYGKDFHLIQANKVRTRSVGECVAFYYMWKKSERYDFFAQQTRFGKKKYNLHPGVTDYMDRLLDESESAASSRAPSPPPTASNSSNSQSEKEDGTVSTANQNGVSSNGPGEILNKEEVKVEGLHINGPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPGSSEFFQEAVSHGKFEELENTDD 182C92C7FC5063AD hdac1-mier1 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait direct interaction direct interaction fig 2B mier1-hdac1 4 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey direct interaction direct interaction fig 2C mier1-hdac1-1 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association fig 3C hdac1-mier1-1 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association fig 3A