UniProt UniProt http://www.uniprot.org Caspy, a zebrafish caspase, activated by ASC oligomerization is required for pharyngeal arch development. Caspy, a zebrafish caspase, activated by ASC oligomerization is required for pharyngeal arch development. J. Biol. Chem. (0021-9258) 2003 imex curation Masumoto J., Zhou W., Chen F.F., Su F., Kuwada J.Y., Hidaka E., Katsuyama T., Sagara J., Taniguchi S., Ngo-Hazelett P., Postlethwait J.H., Nunez G., Inohara N. ino@umich.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Masumoto J., Zhou W., Chen F.F., Su F., Kuwada J.Y., Hidaka E., Katsuyama T., Sagara J., Taniguchi S., Ngo-Hazelett P., Postlethwait J.H., Nunez G., Inohara N. ino@umich.edu Accepted 2012-OCT-26 by PPORRAS 15-Nov-2012: Contacted by pporras. J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation Caspy, a zebrafish caspase, activated by ASC oligomerization is required for pharyngeal arch development. Caspy, a zebrafish caspase, activated by ASC oligomerization is required for pharyngeal arch development. J. Biol. Chem. (0021-9258) 2003 imex curation Masumoto J., Zhou W., Chen F.F., Su F., Kuwada J.Y., Hidaka E., Katsuyama T., Sagara J., Taniguchi S., Ngo-Hazelett P., Postlethwait J.H., Nunez G., Inohara N. ino@umich.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Masumoto J., Zhou W., Chen F.F., Su F., Kuwada J.Y., Hidaka E., Katsuyama T., Sagara J., Taniguchi S., Ngo-Hazelett P., Postlethwait J.H., Nunez G., Inohara N. ino@umich.edu Accepted 2012-OCT-26 by PPORRAS 15-Nov-2012: Contacted by pporras. J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation caspa_danre Caspase a caspa caspy casp1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MAKSIKDHLQDALSNIGADNLRRFQSRLGDRKQEPRVRKSTIEKLKDEIDLVDLLVNTFTSDAVSVTVDILRGIKCNAVAEELLENTGQGGVSQPEPPVPEPIPKDPAQLKELKVTPCSQQFKNKILREKGQETYEIKDKSVRKRLALLINNVDFDDKAMKRSGSEKDEENMEKLLKELDYQVVKRPNLSAKEMDEAIRDFAQREEHKYSDSAFVVIMSHGKRDAIMGVHYHRTNNPSDSFPVDNVYRRLNSENCPALRDKPKVILIQACRGGEHGRVWASDGEPDEPIEIEDDDFVHKEKDFISLMSCTPDTKSYRHVQNGTFYVQTLVDVFIKCAHEDHIEELFRKVLRRFEHPNMIGNFKQMACKDRATLPKLFYLFPGL 21890871309774C3 asc_danre Apoptosis-associated speck-like protein containing a CARD pycard asc asc1 PYD and CARD domain-containing protein protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MAESFKEHLQEAFEDLGADNLRKFKSKLGDRRQEPRVTKSAIEKLKDEIDLADLMVGVFTSKDAVSVTVEILRAIKCNAVADDLLRNTGQSESKGALSDESKCASSKAVSKVAFSKVNFIDEHWKELIDRVNNVDPILDILRQKKVITNEDYCTIRNKETPQKKMRELLTGPITCAGNKGKEVLYDALRESNKFLMDDLEDAE EF457179EB7A78A7 caspa-pycard 1 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 caspa-pycard-2 2 4 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined DsRed tag (Discosoma sp. red fluorescent protein). 3 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 6