UniProt UniProt http://www.uniprot.org The N-terminal conserved domain of rubella virus capsid interacts with the C-terminal region of cellular p32 and overexpression of p32 enhances the viral infectivity. The N-terminal conserved domain of rubella virus capsid interacts with the C-terminal region of cellular p32 and overexpression of p32 enhances the viral infectivity. Virus Res. (0168-1702) 2002 imex curation Mohan K.V., Ghebrehiwet B., Atreya C.D. Virus - Publications including interactions involving viral proteins atreya@cber.fda.gov 15-Nov-2012: Contacted by pporras. human lung diploid WI-38 cell line Only protein-protein interactions chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mohan K.V., Ghebrehiwet B., Atreya C.D. Virus - Publications including interactions involving viral proteins Vero cells have been infected with rubella virus. atreya@cber.fda.gov Accepted 2012-NOV-01 by PPORRAS 15-Nov-2012: Contacted by pporras. human lung diploid WI-38 cell line Virus Res. (0168-1702) 2002 Only protein-protein interactions imex curation The N-terminal conserved domain of rubella virus capsid interacts with the C-terminal region of cellular p32 and overexpression of p32 enhances the viral infectivity. The N-terminal conserved domain of rubella virus capsid interacts with the C-terminal region of cellular p32 and overexpression of p32 enhances the viral infectivity. Virus Res. (0168-1702) 2002 imex curation Mohan K.V., Ghebrehiwet B., Atreya C.D. Virus - Publications including interactions involving viral proteins atreya@cber.fda.gov 15-Nov-2012: Contacted by pporras. human lung diploid WI-38 cell line Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mohan K.V., Ghebrehiwet B., Atreya C.D. Virus - Publications including interactions involving viral proteins atreya@cber.fda.gov Accepted 2012-NOV-01 by PPORRAS 15-Nov-2012: Contacted by pporras. human lung diploid WI-38 cell line Virus Res. (0168-1702) 2002 Only protein-protein interactions imex curation The N-terminal conserved domain of rubella virus capsid interacts with the C-terminal region of cellular p32 and overexpression of p32 enhances the viral infectivity. The N-terminal conserved domain of rubella virus capsid interacts with the C-terminal region of cellular p32 and overexpression of p32 enhances the viral infectivity. Virus Res. (0168-1702) 2002 imex curation Mohan K.V., Ghebrehiwet B., Atreya C.D. Virus - Publications including interactions involving viral proteins atreya@cber.fda.gov 15-Nov-2012: Contacted by pporras. human lung diploid WI-38 cell line Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mohan K.V., Ghebrehiwet B., Atreya C.D. Virus - Publications including interactions involving viral proteins atreya@cber.fda.gov Accepted 2012-NOV-01 by PPORRAS 15-Nov-2012: Contacted by pporras. human lung diploid WI-38 cell line Virus Res. (0168-1702) 2002 Only protein-protein interactions imex curation The N-terminal conserved domain of rubella virus capsid interacts with the C-terminal region of cellular p32 and overexpression of p32 enhances the viral infectivity. The N-terminal conserved domain of rubella virus capsid interacts with the C-terminal region of cellular p32 and overexpression of p32 enhances the viral infectivity. Virus Res. (0168-1702) 2002 imex curation Mohan K.V., Ghebrehiwet B., Atreya C.D. Virus - Publications including interactions involving viral proteins atreya@cber.fda.gov 15-Nov-2012: Contacted by pporras. human lung diploid WI-38 cell line Only protein-protein interactions chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed confocal microscopy confocal microscopy immunostaining immunostaining Mohan K.V., Ghebrehiwet B., Atreya C.D. Virus - Publications including interactions involving viral proteins Vero cells have been infected with rubella virus. atreya@cber.fda.gov Accepted 2012-NOV-01 by PPORRAS 15-Nov-2012: Contacted by pporras. human lung diploid WI-38 cell line Virus Res. (0168-1702) 2002 Only protein-protein interactions imex curation c1qbp_chlae Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP Globular head receptor of C1 complement protein Mitochondrial matrix protein p32 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MLPLLRCVPRVLGSAVPSLRAAAPASPFRQLLTPGPRLCARPFGLLSVRAGSERRPGLLRPRGPCACGCGCGLLHTEGDKAFVDFLNDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLMRKVAGEKITVTFNINNSIPPTFDGEEEPTQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSSGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYISFLEDLKSFVKSQ 67526590A80F5177 p07566-pro_0000041308 Capsid protein p110 protein protein rubvt Rubella virus (strain Therien) MASTTPITMEDLQKALEAQSRALRAELAAGASQSRRPRPPRQRDSSTSGDDSGRDSGGPRRRRGNRGRGQRRDWSRAPPPPEERQETRSQTPAPKPSRAPPQQPQPPRMQTGRGGSAPRPELGPPTNPFQAAVARGLRPPLHDPDTEAPTEACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVRGLDGDSAPLPPHTTERIETRSARHPWRIRFGAPQAFLAGLLLATVAVGTARA 1 300 5952039466D0B469 c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ DIP protein Q07021 original sequence version: 129 DIP protein Q07021 original sequence version: 156 2F747FA73BB1314B p07566_pro-c1qbp 3 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure p07566_pro-c1qbp-1 2 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 1A c1qbp-p07566_pro 2 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1B p07566_pro-c1qbp-2 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 3 c1qbp-p07566_pro-1 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 3 c1qbp-p07566_pro-2 4 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association 4