UniProt UniProt http://www.uniprot.org Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic (1398-9219) 2002 imex curation Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic (1398-9219) 2002 imex curation Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Only protein-protein interactions rat-nrk Rattus norvegicus kidney fibroblast cell line NRK nrk Rat kidney fibroblast cell line NRK fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic (1398-9219) 2002 imex curation Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Only protein-protein interactions human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic (1398-9219) 2002 imex curation Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Only protein-protein interactions human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic (1398-9219) 2002 imex curation Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast reverse rrs reverse ras recruitment system reverse RRS reverse rrs predetermined predetermined participant predetermined Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic (1398-9219) 2002 imex curation Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic (1398-9219) 2002 imex curation Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast reverse rrs reverse ras recruitment system reverse RRS reverse rrs nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic (1398-9219) 2002 imex curation Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic (1398-9219) 2002 imex curation Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic (1398-9219) 2002 imex curation Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. Traffic (1398-9219) 2002 imex curation Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation ap2b1_human AP-2 complex subunit beta AP2B1 CLAPB1 Beta-2-adaptin Beta-adaptin Plasma membrane adaptor HA2/AP2 adaptin beta subunit Clathrin assembly protein complex 2 beta large chain AP105B Adaptor protein complex AP-2 subunit beta ADTB2 Adaptor-related protein complex 2 subunit beta protein protein human Homo sapiens Human MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN DIP protein P63010 original sequence version: 98 DIP protein P63010-1 original sequence version: 109 DIP protein P63010 original sequence version: 129 DIP protein P63010 original sequence version: 134 B472EE5B2AE176DF myo6_chick Unconventional myosin-VI MYO6 CMY6 Unconventional myosin-6 protein protein chick Gallus gallus (Chicken) Chicken MEDGKPVWAPHPTDGFQMGMIVDIGTDYLTIEPLNQKGKTFQAAINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKFYSSDAIKKYQGRSLGTLPPHVFAIADKAYRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLLEAFGNAKTIRNNNSSRFGKFVEIHFNEKNSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGAPEDIREKLYLSSPDSFRYLNRGCTRYFATKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFNRMCTAMKKIGLDDAEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCTLKAQSQPALECCAALLGLDEEDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSFFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVRYVDNQDCIDLIEAKLIGVLDILDEENRLPQPSDQHFTSVVHQKHKDHFRLSIPRKSKLAVHRNVRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESKDKFVRQLFESNTNNNKDPKQKAGKLSFISVGNKFKTQLNLLLEKLHSTGSSFIRCIFPNLKMTSHHFEGGQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYLPEKLARLDPRLFCKALFKALGLNEIDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLICSRWKKVQWCSLSVIKLKNKIKYRASACIKIQKTIRMWLCKRKHKPRIDGLIKVRTLKKRLDKFNEVVSALKEGKAETSKQIKELEYSIDASMTKIKTTMMTREQIMKEYDALVRSSEQLLSALQKKKQQEEEAERLRRIQEEMEKERKRREEEEKRRRKEEEERRLKSEIEAKRKQEEEERKKREEEEKRIQAEIEAQLAREREEETQHQAILEQERRDRELAMRIAQTGAELSTEETKLDVGLCRANGTKLQMTAEQMAKEMSEMLSRGPAVQATKAAAGAKKHDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNAETEQRAPKSVTDYAQQNPTAQLPMRQQEIEINRQQRYFRIPFIRPMDQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKAPILLVAGKDDMDMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQNLLK 5F6AEE43A6FB260F dab2_human Disabled homolog 2 DAB2 DOC2 Differentially-expressed protein 2 Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 protein protein human Homo sapiens Human MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILDDQTNKLKSGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSVQSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTSAPAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSPFAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFPAPAVSTQPPSMHSSLLVTPPQPPPRAGPPKDISSDAFTALDPLGDKEIKDVKEMFKDFQLRQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA 5B2F8B510A580A77 dab1_mouse Disabled homolog 1 Dab1 protein protein mouse Mus musculus Mouse MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPNSQPLEDFESRFAAATPNRNLSMDFDELLEATKVSAVTQLELFGDMSTPPDITSPPTPATPGDAFLPSSSQTLPGSADVFGSMSFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQIAMGAQPPVAQVIPGAQPIAWGQPGLFPATQQAWPTVAGQFPPAAFMPTQTVMPLAAAMFQGPLTPLATVPGTNDSARSSPQSDKPRQKMGKESFKDFQMVQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHVSDPTADDIFEEGFESPSKSEEQEAPDGSQASSTSDPFGEPSGEPSGDNISPQDGS DIP protein P97318 original sequence version: 94 08404220792B1DB4 dab2_rat Disabled homolog 2 Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 Dab2 Doc2 C9 Mitogen-responsive phosphoprotein protein protein rat Rattus norvegicus (Rat) Rat MSNEVETSTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKVEEANKAEENGSEALMTLDDQANKLKLGVDQMDLFGDMSTPPDLNNPTESRDILLVDLNSEIDTNQNSLRENPFLTNGVTSCSLPRPKPQASFLPESAFSANLNFFPTPNPDPFRDDPFAQPDQSAPSSFHSLTSADQKKANPGSLSTPQSKGPLNGDTDYFGQQFDQISNRTGKQEAQGGPWPYPSSQTQQAVRTQNGVSEKEQNGFHIKSSPNPFVGSPPKGLSVPNGVKQDLESSVQSSAHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFASEPPGQMSPTGQPAVPQANFMDLFKTSAPAPMGSGPLVGLGTVPVTPPQAGPWTPVVFTPSTTVVPGAIISGQPSGFGQPLVFGTTPAVQVWNQPSSFATAASPPPPAVWCPTTSVAPNTWSSTSPLGNPFQSSNIFPPSTISTQSFPQPMMSSVLVTPPQPPPRNGPLKDTLSDAFTGLDPLGDKEVKEVKEMFKDFQLRQPPLVPSRKGETPSSGTSSAFSSYFNNKVGIPQEHVDHDDFDANQLLNKINEPPKPAPRQGVLSGTKSADNSLENPFSKGFSSTNPSVVSQPASSDAHRSPFGNPFA DIP protein O88797 original sequence version: 97 930FB25248ADAC6E dab2_mouse Disabled homolog 2 Mitogen-responsive phosphoprotein Dab2 Doc2 Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 protein protein mouse Mus musculus Mouse MSNEVETSTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKKVEEANKAEENGSEALMTLDDQANKLKLGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGVTSCSLPRPKPQASFLPENAFSANLNFFPTPNPDPFRDDPFAQPDQSAPSSFDSLTSPDQKKASLSSSSTPQSKGPLNGDTDYFGQQFDQLSNRTGKPEAQGGPWPYPSSQTQQAVRTQNGVSEREQNGFHIKSSPNPFVGSPPKGLSVPNGVKQDLESSVQSSAHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFASEPPGQMSPTGQPAVPQSNFLDLFKGNAPAPVGPLVGLGTVPVTPPQAGPWTPVVYSPSTTVVPGAIISGQPPSFRQPLVFGTTPAVQVWNQSPSFATPASPPPPTVWCPTTSVAPNAWSSTSPLGNPFQSNNIFPPPTMSTQSSPQPMMSSVLATPPQPPPRNGPLKDIPSDAFTGLDPLGDKEVKEVKEMFKDFQLRQPPLVPSRKGETPPSGTSSAFSSYFNNKVGIPQEHVDHDDFDANQLLNKINEPPKPAPRQGVLLGTKSADNSLENPFSKGFSSSNPSVVSQPASSDPHRSPFGNPFA DIP protein P98078 original sequence version: 127 856C946BD43C4B07 myo6_human Unconventional myosin-VI MYO6 KIAA0389 Unconventional myosin-6 protein protein human Homo sapiens Human MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESRDKFIRELFESSTNNNKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKSTMMTQEQIQKEYDALVKSSEELLSALQKKKQQEEEAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQQQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRSLDSYPVSKNDGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK DIP protein Q9UM54 original sequence version: 150 DIP protein Q9UM54-3 original sequence version: 161 DIP protein Q9UM54 original sequence version: 161 3A8966E6864B8576 myo6-dab2 8 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain 14 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure myo6-dab2-1 10 14 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain physical association physical association 1A dab2-myo6-1 7 17 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined c-term range C-terminal range c-term range physical association physical association no figure dab2-myo6-2 5 17 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined c-term range C-terminal range c-term range physical association physical association 1B dab2-myo6-4 1 14 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 1C myo6-dab2-2 11 17 unspecified role unspecified role prey prey cell lysate cell lysate mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2A C-terminal region of myoVI as indicated by the authors does not fully match with uniprot sequence myo6-dab2-3 6 17 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P98078:p.Ser682_Phe684delinsAlaAlaAla mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain SYF AAA Thu Jul 07 12:17:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ser682ala-tyr683ala-phe684ala Fri Jul 22 11:12:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser682ala,tyr683ala,phe684ala' Wed May 02 16:47:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_tyr_phe682-684ala_ala_ala' Tue Jun 30 16:04:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser682_Phe684delinsAlaAlaAla' P98078:p.Asp699_Asp701delinsAlaAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain DFD AAA Thu Jul 07 12:17:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asp699ala-phe700ala-asp701ala Fri Jul 22 10:56:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp699ala,phe700ala,asp701ala' Wed May 02 15:20:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_phe_asp699-701ala_ala_ala' Tue Jun 30 18:56:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp699_Asp701delinsAlaAlaAla' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 13 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association 2B and 5B C-terminal region of myoVI as indicated by the authors does not fully match with uniprot sequence myo6-dab2-4 4 18 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 3A dab2-ap2b1 4 14 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association 3A myo6-dab2-5 9 17 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3B clathrin heavy chain also precipitated myo6-dab1 6 13 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated P97318:p.Ser478_Phe480delinsAlaAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain SYF AAA Thu Jul 07 12:17:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ser478ala-tyr479ala-phe480ala Fri Jul 22 11:09:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser478ala,tyr479ala,phe480ala' Wed May 02 16:26:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_tyr_phe478-480ala_ala_ala' Tue Jun 30 19:10:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser478_Phe480delinsAlaAlaAla' region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association 4A and 5C C-terminal region of myoVI as indicated by the authors does not fully match with uniprot sequence myo6-dab1-1 9 18 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 4B clathrin heavy chain also precipitated dab2-myo6-5 3 14 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component colocalization colocalization 6 dab2-myo6-6 2 13 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind range range range range region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role neutral component neutral component colocalization colocalization 7 and 8 C-terminal region of myoVI as indicated by the authors does not fully match with uniprot sequence