mbinfo MBInfo http://www.mechanobio.info/ Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Curr. Biol. (0960-9822) 2001 imex curation Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Human brain cDNA Curr. Biol. (0960-9822) 2001 Only protein-protein interactions imex curation Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Curr. Biol. (0960-9822) 2001 imex curation Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Curr. Biol. (0960-9822) 2001 Only protein-protein interactions imex curation Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Curr. Biol. (0960-9822) 2001 imex curation Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Curr. Biol. (0960-9822) 2001 Only protein-protein interactions imex curation Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Curr. Biol. (0960-9822) 2001 imex curation Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Curr. Biol. (0960-9822) 2001 Only protein-protein interactions imex curation Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Curr. Biol. (0960-9822) 2001 imex curation Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Curr. Biol. (0960-9822) 2001 Only protein-protein interactions imex curation Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex. Curr. Biol. (0960-9822) 2001 imex curation Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Krugmann S., Jordens I., Gevaert K., Driessens M., Vandekerckhove J., Hall A. Interactions involving CDC42 could not be captured as the origin of the protein could not be traced. alan.hall@ucl.ac.uk Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Curr. Biol. (0960-9822) 2001 Only protein-protein interactions imex curation rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 baip2_human Brain-specific angiogenesis inhibitor 1-associated protein 2 Insulin receptor substrate protein of 53 kDa Insulin receptor substrate p53/p58 Fas ligand-associated factor 3 BAIAP2 protein protein human Homo sapiens Human MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR DIP protein Q9UQB8 original sequence version: 87 3B9EDC6405DCC99D enah_mouse Protein enabled homolog Enah Mena Ndpp1 NPC-derived proline-rich protein 1 protein protein mouse Mus musculus Mouse MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQEAAQSKVTATQDSTNLRCIFCGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERMERERLERERLERERLERERLEQEQLERQRQEREHVERLERERLERLERERQERERERLEQLEREQVEWERERRMSNAAPSSDSSLSSAPLPEYSSCQPPSAPPPSYAKVISAPVSDATPDYAVVTALPPTSTPPTPPLRHAATRFATSLGSAFHPVLPHYATVPRPLNKNSRPSSPVNTPSSQPPAAKSCAWPTSNFSPLPPSPPIMISSPPGKATGPRPVLPVCVSSPVPQMPPSPTAPNGSLDSVTYPVSPPPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSPSAGAPASAETPLNPELGDSSASEPGLQAASQPAESPTPQGLVLGPPAPPPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPPLPASGIFSGSTSEDNRPLTGLAAAIAGAKLRKVSRVEDGSFPGGGNTGSVSLASSKADAGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNGSKSPVISRPKSTPSSQPSANGVQTEGLDYDRLKQDILDEMRKELAKLKEELIDAIRQELSKSNTA 592BB975EE20F77F enah_human Protein enabled homolog ENAH MENA protein protein human Homo sapiens Human MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIGVNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA BF3252F6FCD1988B baiap2-baiap2 3 8 unspecified role unspecified role putative self putative self region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined IRSp53 8 unspecified role unspecified role putative self putative self region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 17 13 physical association physical association Fig. 3a A 178 amino acid fragment derived from the N-terminus of IRSp53 (NT IRSp53) interacted with the central region of IRSp53 (ΔNTΔCT IRSp53), encompassing residues 180 to 317, which contains the cdc42 binding domain, but not with a C-terminal fragment (CT IRSp53). The N-terminus of IRSp53 is considered as an autoinhibitory region. enah-baiap2 5 9 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro IRSp53 8 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 5b The Mena protein interacted strongly with the SH3 domain-containing C-terminal part of IRSp53 (GST-CT, aa319-521). It also interacted weakly with GST-ΔCT (aa1-317), also it did not interact with GST-NT (aa1-178) and GST-ΔNTΔCT (aa180-317) separately. The cell lysates with coexpression of ΔNT IRSp53 and NT IRSp53 show no interaction between Mena proteins and IRSp53 fragments, which indicated that the N-terminus of IRSp53 might be an autoinhibitory region. (Fig. 6a right panel) baiap2-enah 2 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 8 inhibitor inhibitor unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c terminus sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 6a (right panel) The N-terminal fragment of IRSp53 proteins (NT IRSp53) interacted with the fragment of IRSp53 lack of N-terminus (ΔNT IRSp53). baiap2-enah 6 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 5a baiap2-enah 4 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association Table. 1 rac1-baiap2 1 7 unspecified role unspecified role bait bait P63000:p.Gln61Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 14:55:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu' Tue Jun 30 19:13:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln61Leu' P63000:p.Tyr40Cys mutation mutation certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 15:33:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40cys' Tue Jun 30 17:08:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr40Cys' 8 unspecified role unspecified role prey prey physical association physical association -