UniProt UniProt http://www.uniprot.org PA subunit from influenza virus polymerase complex interacts with a cellular protein with homology to a family of transcriptional activators. PA subunit from influenza virus polymerase complex interacts with a cellular protein with homology to a family of transcriptional activators. J. Virol. (0022-538X) 2001 mimix curation Huarte M., Sanz-Ezquerro J.J., Roncal F., Ortin J., Nieto A. anmartin@cnb.uam.es 19-Jun-2012: Contacted by JYOTI. human kidney cDNA library yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Huarte M., Sanz-Ezquerro J.J., Roncal F., Ortin J., Nieto A. anmartin@cnb.uam.es Accepted 2012-MAR-20 by MGT human kidney cDNA library J. Virol. (0022-538X) 2001 mimix curation PA subunit from influenza virus polymerase complex interacts with a cellular protein with homology to a family of transcriptional activators. PA subunit from influenza virus polymerase complex interacts with a cellular protein with homology to a family of transcriptional activators. J. Virol. (0022-538X) 2001 mimix curation Huarte M., Sanz-Ezquerro J.J., Roncal F., Ortin J., Nieto A. anmartin@cnb.uam.es 19-Jun-2012: Contacted by JYOTI. human kidney cDNA library in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Huarte M., Sanz-Ezquerro J.J., Roncal F., Ortin J., Nieto A. anmartin@cnb.uam.es Accepted 2012-MAR-20 by MGT 19-Jun-2012: Contacted by JYOTI. human kidney cDNA library J. Virol. (0022-538X) 2001 mimix curation PA subunit from influenza virus polymerase complex interacts with a cellular protein with homology to a family of transcriptional activators. PA subunit from influenza virus polymerase complex interacts with a cellular protein with homology to a family of transcriptional activators. J. Virol. (0022-538X) 2001 mimix curation Huarte M., Sanz-Ezquerro J.J., Roncal F., Ortin J., Nieto A. anmartin@cnb.uam.es 19-Jun-2012: Contacted by JYOTI. human kidney cDNA library yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Huarte M., Sanz-Ezquerro J.J., Roncal F., Ortin J., Nieto A. anmartin@cnb.uam.es Accepted 2012-MAR-20 by MGT 19-Jun-2012: Contacted by JYOTI. human kidney cDNA library J. Virol. (0022-538X) 2001 mimix curation PA subunit from influenza virus polymerase complex interacts with a cellular protein with homology to a family of transcriptional activators. PA subunit from influenza virus polymerase complex interacts with a cellular protein with homology to a family of transcriptional activators. J. Virol. (0022-538X) 2001 mimix curation Huarte M., Sanz-Ezquerro J.J., Roncal F., Ortin J., Nieto A. anmartin@cnb.uam.es 19-Jun-2012: Contacted by JYOTI. human kidney cDNA library in vitro In vitro peptide array peptide array anti tag western anti tag western blot anti tag western Huarte M., Sanz-Ezquerro J.J., Roncal F., Ortin J., Nieto A. anmartin@cnb.uam.es Accepted 2012-MAR-20 by MGT 19-Jun-2012: Contacted by JYOTI. human kidney cDNA library J. Virol. (0022-538X) 2001 mimix curation rtraf_human RNA transcription, translation and transport factor protein RTRAF C14orf166 CLE7 homolog CGI-99 protein protein human Homo sapiens Human MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR EB2C3C5577A09A2A pa_i75a3 Polymerase acidic protein PA RNA-directed RNA polymerase subunit P2 protein protein i75a3 Influenza A virus (strain A/Victoria/3/1975 H3N2) MEDFVRQCFNPMIVELAEKAMKEYGEDLKIETNKFAAICTHLEVCFMYSDFHFINEQGESIVVELDDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSENTHIHIFSFTGEGMATKADYTLDEESRARIKTRLFTIRQEMANRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSCLENFRAYVDGFEPNGCIEGKLSQMSKEVNAKIEPFLKTTPRPIKLPDGPPCFQRSKFLLMDALKLSIEDPSHEGEGIPLYDAIKCMRTFFGWKEPYIVKPHERGINSNYLLSWKQVLAELQDIENEEKIPRTKNMKKTSQLKWALGENMAPEKVDFDNCRDISDLKQYDSDEPELRSLSSWIQNEFNKACELTDSIWIELDEIGEDVAPIEYIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRSAIGQMSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSAESRKLLLVVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALR DIP protein P31343 original sequence version: 76 B1FC817C171BB50F pa-c14orf166 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association no figure pa-c14orf166-1 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association no figure pa-c14orf166-2 2 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 5B pa-c14orf166-3 4 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 5D