UniProt UniProt http://www.uniprot.org Multiple distinct targeting signals in integral peroxisomal membrane proteins. Multiple distinct targeting signals in integral peroxisomal membrane proteins. J. Cell Biol. (0021-9525) 2001 imex curation Jones J.M., Morrell J.C., Gould S.J. sgould@jhmi.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jones J.M., Morrell J.C., Gould S.J. sgould@jhmi.edu Accepted 2012-APR-17 by ORCHARD J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation pex19_human Peroxisomal biogenesis factor 19 PEX19 HK33 PXF OK/SW-cl.22 Peroxin-19 Peroxisomal farnesylated protein 33 kDa housekeeping protein protein protein human Homo sapiens Human MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM 399AF6B79F219100 pm34_human Peroxisomal membrane protein PMP34 34 kDa peroxisomal membrane protein Solute carrier family 25 member 17 SLC25A17 PMP34 protein protein human Homo sapiens Human MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKRAHQH B7043D82966D47A5 pex19-slc25a17-3 1 2 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 7a and 7b