mbinfo MBInfo http://www.mechanobio.info/ Activation of LIM kinases by myotonic dystrophy kinase-related Cdc42-binding kinase alpha. Activation of LIM kinases by myotonic dystrophy kinase-related Cdc42-binding kinase alpha. J. Biol. Chem. (0021-9258) 2001 imex curation Sumi T., Matsumoto K., Shibuya A., Nakamura T. LIMK2 autophosphorylation (Fig 1B, 2B, 2C) were not curated since there were no definitive bands visible on the gel. In vitro kinase assays involving LIMK1/LIMK2 and GST-cofilin (Fig 1A, 1B, 2B, 2C, 3A, 3C) could not be curated since the specific cofilin isoform (cofilin 1/cofilin 2) used in these experiments could not be identified. nakamura@onbich.med.osaka-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Sumi T., Matsumoto K., Shibuya A., Nakamura T. LIMK2 autophosphorylation (Fig 1B, 2B, 2C) were not curated since there were no definitive bands visible on the gel. In vitro kinase assays involving LIMK1/LIMK2 and GST-cofilin (Fig 1A, 1B, 2B, 2C, 3A, 3C) could not be curated since the specific cofilin isoform (cofilin 1/cofilin 2) used in these experiments could not be identified. nakamura@onbich.med.osaka-u.ac.jp Accepted 2013-DEC-13 by ORCHARD J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation mrcka_rat Serine/threonine-protein kinase MRCK alpha Myotonic dystrophy kinase-related CDC42-binding kinase alpha Cdc42bpa Pk428 CDC42-binding protein kinase alpha protein protein rat Rattus norvegicus (Rat) Rat MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDSKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEEMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPTQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELTRKLQESTQTVQALQYSTVDGPLTASKDLEIKSLKEEIEKLRKQVAEVNHLEQQLEEANSVRRELDDAFRQIKAFEKQIKTLQQEREELNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKAESLRQELRRAERAKKELEVHTEALIAEASKDRKLREQSRHYSKQLENELEGLKQKQISYSPGICSIEHQQEITKLKTDLEKKSIFYEEEISKREGIHASEIKNLKKELHDSEGQQLALNKEIMVLKDKLEKTRRESQSEREEFENEFKQQYEREKVLLTEENKKLTSELDKLTSLYESLSLRNQHLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGVEHRDSQHSFLAFLNTPTDALDQFERSPSCTPAGKGRRIADSAPLPVHTPTLRKKGCPASAGFPPKRKTHQFFVKSFTAPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTTCPVPPEQTKGPLGIDPQKGVGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYDIAEGKASQPSSVISQVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSAPSDKCSILMLADSETERSKWVGVLSELHKVLKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERVALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPSDQLVAVISGRNRHVRLFPMSALDGRETDFYKLAETKGCQTIAAGKVRHGALSCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPCNVQWMAIFSEHLCVGFQSGFLRYPLNGEGSPCNMLHSNDHTLAFITHQPMDAICAVEISNKEYLLCFSSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSIYSENAVDIFDVNSMEWIQTLPLKKVRPLNTEGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKSRPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYNTKRQPMPSPSEGSLSSGGVDQGSDAPVRDYDGEDSDSPRHSTASNSSNLSSPPSPVSPRKTKSLSLESTDRGSWDP 65F62F7872ACCD3B limk2_rat LIM domain kinase 2 Limk2 protein protein rat Rattus norvegicus (Rat) Rat MAALAGEEAWRCRGCGNYVPLSQRLYRTANEAWHSSCFRCSECQESLTNWYYEKDGKLYCHKDYWAKFGEFCHGCSLLMTGPAMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTESVQDQLPYSVTLISMPATTECRRGFSVSVESASSNYATTVQVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAINQTSQTLQLLIEHDPVPQRLDQLRLDTRLSPHMQSSGHTLMLSTLDAKENQEGTLRRRSLRRSNSISKSPGPSSPKEPLLLSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRNVDPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKRPPVEKAATKKRTLRKSDRKKRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCKLEPESRPAFSKLEDSFEALSLFLGELAIPLPAELEELDHTVSMEYGLTRDSPP A7E2D525751BE4F3 limk1_rat LIM domain kinase 1 Limk1 Limk protein protein rat Rattus norvegicus (Rat) Rat MRLTLLCCTWREERMGEEGSELPVCASCSQSIYDGQYLQALNADWHADCFRCCECSTSLSHQYYEKDGQLFCKKDYWARYGESCHGCSEHITKGLVMVGGELKYHPECFICLACGNFIGDGDTYTLVEHSKLYCGQCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASAHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHIGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDSLGHGPVSDPSPLASPVHTPSGQAGSSARQKPVLRSCSIDTSPGAGSLVSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFGLARLMIDEKGQSEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEQWLETLRMHLAGHLPLGPQLEQLERGFWETYRRGESSLPAHPEVPD 51099F87703BB051 limk1-2 1 4 unspecified role unspecified role putative self putative self c-terminal region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 phosphorylation phosphorylation reaction phosphorylation true Fig 1A, 2B (left), 2C (lanes 1,2,5). LIMK1 autophosphorylation was stimulated by the presence of the dominant active form of Cdc42, Cdc42V12, but not the ROCK inhibitor, Y-27632. LIMK1 autophosphorylation was not affected in the presence of dominant active form of MRCK-alpha: MRCK-deltaC, or in the presence of the kinase dead form: MRCK-deltaC/KD. LIMK1 autophosphorylation was enhanced in the presence of wild type MRCK-alpha and wild type ROCK. cdc42bpa-limk1 1 4 enzyme target enzyme target substrate substrate unspecified role unspecified role kinase domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 2 enzyme enzyme unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain This region of MRCK-alpha depicts the C-terminal deleted MRCK-alpha transcript and is shown to be sufficient for phosphorylating LIMK1, since no full length MRCK-alpha was used in the experiment. O54874:p.Lys106Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:58:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys106ala' Tue Jun 30 15:35:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys106Ala' chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 phosphorylation phosphorylation reaction phosphorylation Fig 3B. The phosphorylation of LIMK1-KD by MRCK-alpha was shown only using a C-terminal truncated MRCK-deltaC fragment, and not using a full length MRCK-alpha. P53669 increases activity of O54874 cdc42bpa-limk2 1 3 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined kinase domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 2 enzyme enzyme unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain This region depicts the C-terminal truncated fragment of MRCK-alpha and is shown to be sufficient to phosphorylate LIMK2-KD, since the full length MRCK-alpha was not used in the experiment. O54874:p.Lys106Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:01:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys106ala' Tue Jun 30 17:29:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys106Ala' chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 phosphorylation phosphorylation reaction phosphorylation Fig 3B (lanes 5,6). The phosphorylation of LIMK2 by MRCK-alpha was shown using only the C-terminal truncated MRCK-deltaC fragment and not using the full length MRCK-alpha. O54874 increases activity of P53670 cdc42bpa-1 1 2 putative self putative self putative self putative self O54874:p.Lys106Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:44:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys106ala' Tue Jun 30 19:21:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys106Ala' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain This region depicts the C-terminal truncated fragment of MRCK-alpha and is shown to be sufficient for autophosphorylation, since full length MRCK-alpha was not used in the experiment. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 phosphorylation phosphorylation reaction phosphorylation true Fig 3B (lanes 1,3,5), 3C.