mbinfo MBInfo http://www.mechanobio.info/ Cdc42Hs facilitates cytoskeletal reorganization and neurite outgrowth by localizing the 58-kD insulin receptor substrate to filamentous actin. Cdc42Hs facilitates cytoskeletal reorganization and neurite outgrowth by localizing the 58-kD insulin receptor substrate to filamentous actin. J. Cell Biol. (0021-9525) 2001 imex curation Govind S., Kozma R., Monfries C., Lim L., Ahmed S. Interaction detection: Yeast two-hybrid screening. The source of Cdc42 specified by the author and the source of IRSp53, PAK1, PAK3 and ACK inferred from the cDNA library (human adult brain library) used. s.ahmed@ion.ucl.ac.uk 11-Oct-2012: Contacted by IntAct-Help. Human adult brain library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Govind S., Kozma R., Monfries C., Lim L., Ahmed S. Interaction detection: Yeast two-hybrid screening. The source of Cdc42 specified by the author and the source of IRSp53, PAK1, PAK3 and ACK inferred from the cDNA library (human adult brain library) used. s.ahmed@ion.ucl.ac.uk Accepted 2012-OCT-02 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Human adult brain library. J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation Cdc42Hs facilitates cytoskeletal reorganization and neurite outgrowth by localizing the 58-kD insulin receptor substrate to filamentous actin. Cdc42Hs facilitates cytoskeletal reorganization and neurite outgrowth by localizing the 58-kD insulin receptor substrate to filamentous actin. J. Cell Biol. (0021-9525) 2001 imex curation Govind S., Kozma R., Monfries C., Lim L., Ahmed S. Interaction detection: Yeast two-hybrid screening. The source of Cdc42 specified by the author and the source of IRSp53, PAK1, PAK3 and ACK inferred from the cDNA library (human adult brain library) used. s.ahmed@ion.ucl.ac.uk 11-Oct-2012: Contacted by IntAct-Help. Human adult brain library. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Govind S., Kozma R., Monfries C., Lim L., Ahmed S. Interaction detection: Yeast two-hybrid screening. The source of Cdc42 specified by the author and the source of IRSp53, PAK1, PAK3 and ACK inferred from the cDNA library (human adult brain library) used. s.ahmed@ion.ucl.ac.uk Accepted 2012-OCT-02 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Human adult brain library. J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation baip2_human Brain-specific angiogenesis inhibitor 1-associated protein 2 Insulin receptor substrate protein of 53 kDa Insulin receptor substrate p53/p58 Fas ligand-associated factor 3 BAIAP2 protein protein human Homo sapiens Human MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR DIP protein Q9UQB8 original sequence version: 87 3B9EDC6405DCC99D pak3_human Serine/threonine-protein kinase PAK 3 PAK3 OPHN3 Beta-PAK Oligophrenin-3 p21-activated kinase 3 protein protein human Homo sapiens Human MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR BC39AEC6F0A5478B p60953-2 Cell division control protein 42 homolog CDC42 G25K GTP-binding protein Placental protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60953-2 original sequence version: 152 DIP protein P60953 original sequence version: 98 DIP protein P60953 original sequence version: 148 DIP protein P60953 original sequence version: 142 DIP protein P60953-2 original sequence version: 135 DIP protein P60953 original sequence version: 99 DIP protein P60953-2 original sequence version: 139 DIP protein P60953 original sequence version: 144 DIP protein P60953 original sequence version: 163 DIP protein P60953 original sequence version: 158 DIP protein P60953-2 original sequence version: 147 DIP protein P60953 original sequence version: 123 51A437E22A4D8FFF pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein Q13153 original sequence version: 161 DIP protein Q13153 original sequence version: 122 DIP protein Q13153 original sequence version: 134 DIP protein Q13153 original sequence version: 165 1A95CD5F2195CD7B ack1_human Activated CDC42 kinase 1 ACK1 TNK2 Tyrosine kinase non-receptor protein 2 protein protein human Homo sapiens Human MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELYLGNPMDPPDLLSVELSTSRPPQHLGGVKKPTYDPVSEDQDPLSSDFKRLGLRKPGLPRGLWLAKPSARVPGTKASRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLLDETPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEICSINSTLVGAGVPAGPSQGQTNYAFVPEQARPPPPLEDNLFLPPQGGGKPPSSAQTAEIFQALQQECMRQLQAPAGSPAPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCILPIVRDGKKVSSTHYYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLLLPPPSTPAPAAPTATVRPMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPADKIQMAMVHGVTTEECQAALQCHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSWGPAHHKR DIP protein Q07912 original sequence version: 150 DIP protein Q07912 original sequence version: 117 74A1980665BC3E6B cdc42-baiap2-3 1 5 unspecified role unspecified role bait bait P60953-2:p.[Gln61Leu;Val189Ser] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V S certain certain sequence position certain certain certain sequence position certain Q L Fri Jul 22 10:50:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val189ser,gln61leu' Wed May 02 14:24:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu,val189ser' Tue Jun 30 18:10:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln61Leu;Val189Ser]' 3 unspecified role unspecified role prey prey physical association physical association See text, no figure reference. cdc42-pak3-4 1 5 unspecified role unspecified role bait bait P60953-2:p.[Gln61Leu;Val189Ser] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L certain certain sequence position certain certain certain sequence position certain V S Wed May 02 18:34:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu,val189ser' Tue Jun 30 19:29:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln61Leu;Val189Ser]' 4 unspecified role unspecified role prey prey physical association physical association See text, no figure reference. cdc42-pak1-10 1 5 unspecified role unspecified role bait bait P60953-2:p.[Gln61Leu;Val189Ser] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L certain certain sequence position certain certain certain sequence position certain V S Wed May 02 17:31:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu,val189ser' Tue Jun 30 18:36:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln61Leu;Val189Ser]' 6 unspecified role unspecified role prey prey physical association physical association See text, no figure reference. cdc42-tnk2-3 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait P60953-2:p.[Gln61Leu;Val189Ser] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L certain certain sequence position certain certain certain sequence position certain V S Wed May 02 16:44:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu,val189ser' Tue Jun 30 18:41:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln61Leu;Val189Ser]' physical association physical association See text, no figure reference. cdc42-baiap2-5 2 5 unspecified role unspecified role bait bait P60953-2:p.Gln61Leu mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 16:14:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu' Tue Jun 30 19:16:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln61Leu' P60953-2:p.[Tyr40Cys;Gln61Leu] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L certain certain sequence position certain certain certain sequence position certain Y C Fri Jul 22 11:12:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu,tyr40cys' Wed May 02 18:51:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40cys,gln61leu' Tue Jun 30 18:24:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr40Cys;Gln61Leu]' P60953-2:p.[Phe37Ala;Gln61Leu] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L certain certain sequence position certain certain certain sequence position certain F A Fri Jul 22 10:58:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu,phe37ala' Wed May 02 15:32:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe37ala,gln61leu' Tue Jun 30 16:37:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe37Ala;Gln61Leu]' 3 unspecified role unspecified role prey prey Q9UQB8:p.[Ile267Asn;Pro270Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I N certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:19:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile267asn,pro270ala' Tue Jun 30 18:45:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile267Asn;Pro270Ala]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain [202-305] was taken as the binding site for IRSp53 because the binding of Cdc42Hs with the IRSp53[267-305] region was significantly weak compared to binding with IRSp53[202-305]. Q9UQB8:p.Ser268Pro mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S P Wed May 02 19:38:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser268pro' Tue Jun 30 18:07:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser268Pro' Q9UQB8:p.Ile267Asn mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I N Wed May 02 14:52:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile267asn' Tue Jun 30 19:53:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile267Asn' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2A(lanes 1-3), 2B(lanes 1,2), 2C(lanes 1-3), 3A, 3B, 3C and 3D . IRSp53 binds only to the GTP-bound form of Cdc42Hs, not to the GDP-bound form (Fig 2B). cdc42-pak3-6 2 5 unspecified role unspecified role bait bait P60953-2:p.Gln61Leu mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:21:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu' Tue Jun 30 20:01:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln61Leu' 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2A (lane 5).