UniProt UniProt http://www.uniprot.org Parkin functions as an E2-dependent ubiquitin- protein ligase and promotes the degradation of the synaptic vesicle-associated protein, CDCrel-1. Parkin functions as an E2-dependent ubiquitin- protein ligase and promotes the degradation of the synaptic vesicle-associated protein, CDCrel-1. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 imex curation Zhang Y., Gao J., Chung K.K., Huang H., Dawson V.L., Dawson T.M. tdawson@jhmi.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Y., Gao J., Chung K.K., Huang H., Dawson V.L., Dawson T.M. tdawson@jhmi.edu Accepted 2012-APR-30 by ORCHARD Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 Only protein-protein interactions imex curation Parkin functions as an E2-dependent ubiquitin- protein ligase and promotes the degradation of the synaptic vesicle-associated protein, CDCrel-1. Parkin functions as an E2-dependent ubiquitin- protein ligase and promotes the degradation of the synaptic vesicle-associated protein, CDCrel-1. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 imex curation Zhang Y., Gao J., Chung K.K., Huang H., Dawson V.L., Dawson T.M. tdawson@jhmi.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhang Y., Gao J., Chung K.K., Huang H., Dawson V.L., Dawson T.M. tdawson@jhmi.edu Accepted 2012-APR-30 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Adult mouse brain cDNA Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 Only protein-protein interactions imex curation prkn_human E3 ubiquitin-protein ligase parkin PRKN PARK2 Parkin RBR E3 ubiquitin-protein ligase Parkinson juvenile disease protein 2 protein protein human Homo sapiens Human MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV DIP protein O60260 original sequence version: 99 DIP protein O60260-1 original sequence version: 145 DIP protein O60260-1 original sequence version: 158 DIP protein O60260 original sequence version: 157 9A8BB802A3FC84C3 sept5_mouse Septin-5 Septin5 Cell division control-related protein 1 Peanut-like protein 1 Pnutl1 Sept5 protein protein mouse Mus musculus Mouse MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERINQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNSECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKDRIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDEELRRMQEMLQKMKQQMQDQ D58468DBA9ADE626 ub2l6_human Ubiquitin/ISG15-conjugating enzyme E2 L6 UBE2L6 UBCH8 Ubiquitin-protein ligase L6 Ubiquitin carrier protein L6 UbcH8 Retinoic acid-induced gene B protein E2 ubiquitin-conjugating enzyme L6 protein protein human Homo sapiens Human MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS DIP protein O14933 original sequence version: 136 D79768775344EFAE park2-ube2l6 1 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection O60260:p.Thr415Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T N Wed May 02 19:43:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr415asn' Tue Jun 30 20:03:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr415Asn' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O60260:p.Cys421Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 20:22:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys421ala' Tue Jun 30 18:37:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys421Ala' O60260:p.Thr240Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T R Wed May 02 14:39:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr240arg' Tue Jun 30 17:24:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr240Arg' O60260:p.Cys431Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:17:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys431ala' Tue Jun 30 18:58:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys431Ala' 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B, 2B and C park2-sept5 2 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association no figure park2-sept5-1 1 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cys421ala sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A and B