IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of multiple proteins expressed in murine embryos as binding partners for the WW domains of the ubiquitin-protein ligase Nedd4. Identification of multiple proteins expressed in murine embryos as binding partners for the WW domains of the ubiquitin-protein ligase Nedd4. Biochem. J. (0264-6021) 2000 imex curation Jolliffe C.N., Harvey K.F., Haines B.P., Parasivam G., Kumar S. Two mouse cDNA expression libraries, in lambda-ExLox vector (Novagen) were screened. From each library 400000 pfu were plated on to Petri plates and when the plaques were visible the plates were overlayed with nylon membrane and processed for hybridization with 32P-labelled bait and then exposed to X-ray film. Plaques that bound 32P-labelled bait in two duplicated membranes were excised and phage eluted, plated again and re-tested with 32P-labelled bait. This process was repeated a third time to obtain stocks of pure phage. Plasmids containing cDNA were rescued from the lambda-ExLox clones and the interacting preys were identified by sequencing. sharad.kumar@imvs.sa.gov.au 15-Nov-2012: Contacted by pporras. Mouse embryonic cDNA expression libraries. Only protein-protein interactions in vitro In vitro affinity techniques affinity technology affinity techniques nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Jolliffe C.N., Harvey K.F., Haines B.P., Parasivam G., Kumar S. Two mouse cDNA expression libraries, in lambda-ExLox vector (Novagen) were screened. From each library 400000 pfu were plated on to Petri plates and when the plaques were visible the plates were overlayed with nylon membrane and processed for hybridization with 32P-labelled bait and then exposed to X-ray film. Plaques that bound 32P-labelled bait in two duplicated membranes were excised and phage eluted, plated again and re-tested with 32P-labelled bait. This process was repeated a third time to obtain stocks of pure phage. Plasmids containing cDNA were rescued from the lambda-ExLox clones and the interacting preys were identified by sequencing. sharad.kumar@imvs.sa.gov.au Accepted 2012-OCT-09 by MGT 15-Nov-2012: Contacted by pporras. Mouse embryonic cDNA expression libraries. Biochem. J. (0264-6021) 2000 Only protein-protein interactions imex curation Identification of multiple proteins expressed in murine embryos as binding partners for the WW domains of the ubiquitin-protein ligase Nedd4. Identification of multiple proteins expressed in murine embryos as binding partners for the WW domains of the ubiquitin-protein ligase Nedd4. Biochem. J. (0264-6021) 2000 imex curation Jolliffe C.N., Harvey K.F., Haines B.P., Parasivam G., Kumar S. Two mouse cDNA expression libraries, in lambda-ExLox vector (Novagen) were screened. From each library 400000 pfu were plated on to Petri plates and when the plaques were visible the plates were overlayed with nylon membrane and processed for hybridization with 32P-labelled bait and then exposed to X-ray film. Plaques that bound 32P-labelled bait in two duplicated membranes were excised and phage eluted, plated again and re-tested with 32P-labelled bait. This process was repeated a third time to obtain stocks of pure phage. Plasmids containing cDNA were rescued from the lambda-ExLox clones and the interacting preys were identified by sequencing. sharad.kumar@imvs.sa.gov.au 15-Nov-2012: Contacted by pporras. Mouse embryonic cDNA expression libraries. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Jolliffe C.N., Harvey K.F., Haines B.P., Parasivam G., Kumar S. Two mouse cDNA expression libraries, in lambda-ExLox vector (Novagen) were screened. From each library 400000 pfu were plated on to Petri plates and when the plaques were visible the plates were overlayed with nylon membrane and processed for hybridization with 32P-labelled bait and then exposed to X-ray film. Plaques that bound 32P-labelled bait in two duplicated membranes were excised and phage eluted, plated again and re-tested with 32P-labelled bait. This process was repeated a third time to obtain stocks of pure phage. Plasmids containing cDNA were rescued from the lambda-ExLox clones and the interacting preys were identified by sequencing. sharad.kumar@imvs.sa.gov.au Accepted 2012-OCT-09 by MGT 15-Nov-2012: Contacted by pporras. Mouse embryonic cDNA expression libraries. Biochem. J. (0264-6021) 2000 Only protein-protein interactions imex curation litaf_mouse Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog LITAF-like protein NEDD4 WW domain-binding protein 3 Estrogen-enhanced transcript protein Litaf N4wbp3 Tbx1 protein protein mouse Mus musculus Mouse MSAPGPYQAAAGPSVVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPSYYTQPVPVPNANAIAVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKRL 7397F79C5AD0CD79 nedd4_mouse E3 ubiquitin-protein ligase NEDD4 Neural precursor cell expressed developmentally down-regulated protein 4 Nedd4 Kiaa0093 Nedd-4 Nedd4a HECT-type E3 ubiquitin transferase NEDD4 Nedd4-1 protein protein mouse Mus musculus Mouse MSSDMAADESEAPVLSEDEVWEFCLDKTEDGGGSPGSDVTDTCEPPCGCWELNPNSLEEEHVLFTADPYLELHNDDTRVVRVKVIAGIGLAKKDILGASDPYVRVTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENRLTRDDFLGQVDVPLYPLPTENPRMERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKNGSEDENADQAEELEPGWVVLDQPDAATHLPHPPEPSPLPPGWEERQDVLGRTYYVNHESRRTQWKRPSPDDDLTDEDNDDMQLQAQRAFTTRRQISEDVDGPDNRESPENWEIVREDENTEYSGQAVQSPPSGHIDVQTHLAEEFNTRLAVCGNPATSQPVTSSNHSSRGGSLQTCIFEEQPTLPVLLPTSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQDDPRSKIPAHLRGKTDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQTDIPNKFEMKLRRANILEDSYRRIMGVKRADLLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTELDLRFIIDEELFGQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNHQVIHWFWKAVWMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCFNRLDLPPYESFDELWDKLQMAIENTQGFDGVD DIP protein P46935 original sequence version: 84 AE7DD3ED63986C50 rnf11_mouse RING finger protein 11 Rnf11 N4wbp2 Sid1669 NEDD4 WW domain-binding protein 2 Sid 1669 protein protein mouse Mus musculus Mouse MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPIYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN EF192AB0C2D4BF87 tmg2_mouse Transmembrane gamma-carboxyglutamic acid protein 2 Prrg2 N4wbp1 NEDD4 WW domain-binding protein 1 Proline-rich gamma-carboxyglutamic acid protein 2 protein protein mouse Mus musculus Mouse MRGRPSLLLVYMGLATCLDTSPHREQNQVLDIFLDAPEAQSFLVGRRRFPRANHWDLELLTPGNLERECLEERCSWEEAREYFEDNTLTERFWESYTYNGKGGRGRVDVAGLAVGLTSGILLIVLAGLGAFWYLHYRRRRLRGQESCLQETGLIIPLSPQTPQSPPLPPGLPTYEQALAASGVHDAPPPPYSSLRRPH 1C6482C8445450FC pmepa_mouse Protein TMEPAI Pmepa1 N4wbp4 Tmepai NEDD4 WW domain-binding protein 4 Prostate transmembrane protein androgen induced 1 Transmembrane prostate androgen-induced protein protein protein mouse Mus musculus Mouse MSPARATAQRSLFPSMEITELEFVQIVVIVVVMMVMVVMITCLLSHYKLSARSFISRHSQARRRDDGLSSEGCLWPSESTVSGGMPEPQVYAPPRPTDRLAVPPFIQRSRFQPTYPYLQHEIALPPTISLSDGEEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLIDSTMLGGPCPPSSNSGISATCYSSGGRMEGPPPTYSEVIGHYPGSSFQHQQSNGPSSLLEGTRLHHSHIAPLENKEKEKQKGHPL 31AD07BD16B0D77D wbp1_mouse WW domain-binding protein 1 Wbp1 protein protein mouse Mus musculus Mouse MARASSRNSSEEAWGSLQAPQQQQSPAASSLEGAIWRRAGTQTRALDTILYHPQQSHLLRELCPGVNTQPYLCETGHCCGETGCCTYYYELWWFWLLWTVLILFSCCCAFRHRRAKLRLQQQQRQREINLLAYHGACHGAGPVPTGSLLDLRLLSAFKPPAYEDVVHHPGTPPPPYTVGPGYPWTTSSECTRCSSESSCSAHLEGTNVEGVSSQQSALPHQEGEPRAGLSPVHIPPSCRYRRLTGDSGIELCPCPDSSEGEPLKEARASASQPDLEDHSPCALPPDSVSQVPPMGLASSCGDIP 2A5C95D34D9D7520 bean1_mouse Protein BEAN1 Bean1 Brain-expressed protein associating with Nedd4 protein protein mouse Mus musculus Mouse MSFKRPCPLARYNRTSYFYPTTFSESSEHSHLLVSPVLVASAVIGVVITLSCITIIVGSIRRDRQARIQRHHHRHRRHHHHHRHRRRRHREYASGGHTHSRSSPRMPYACSPAEDWPPPLDVSSEGDVDVTVLWELYPDSPPGYEECMGPGATQLYVPTDAPPPYSMTDSCPRLNGALDSDSGQSRSHRQQEQRTQGQSRLHTVSMDTLPPYEAVCGTGSPSDLLPLPGPEPWPSNSQGSPIPTQAPMPSPERIV 20D3955C31A22B2F wbp2_mouse WW domain-binding protein 2 Wbp2 protein protein mouse Mus musculus Mouse MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANFIKGIVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPNGAYGYPYMPSGAYVFPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPSAPATPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYPPEDKKTQ DA475B184F284380 nfip1_mouse NEDD4 family-interacting protein 1 Ndfip1 N4wbp5 NEDD4 WW domain-binding protein 5 protein protein mouse Mus musculus Mouse MALALAALAAVEPACGSGYQQLQNEEEPGEPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATIPLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY 7699A062161AC6A4 nedd4-bean1 1 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association table 1, fig 2g nedd4-tmg2 1 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association table 1, fig 2a nedd4-rnf11 1 5 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association table 1, fig 2b nedd4-litaf 1 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association table 1, fig 2c nedd4-pmepa 1 7 unspecified role unspecified role prey prey partially purified partially purified c-terminal region sufficient to bind sufficient binding region sufficient to bind range range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association table 1, fig 2e and 2d nedd4-nfip1 1 11 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association table 1, fig 2f nedd4-wbp1 1 8 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association table 1, fig 2h nedd4-wbp2 1 10 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association table 1, fig 2i nedd4-bean1-1 2 9 unspecified role unspecified role prey prey purified purified region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:46:58 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py1 mutation' This is an unspecified mutation in the py domain(s) of this protein. region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:46:59 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py2 mutation' This is an unspecified mutation in the py domain(s) of this protein. tyr144ala,tyr165ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A Wed Jul 06 17:47:00 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py1+py2 mutation' This is an unspecified mutation in the py domain(s) of this protein. n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3a nedd4-wbp1-1 2 8 unspecified role unspecified role prey prey cell lysate cell lysate tyr176ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:47:19 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py2 mutation' This is an unspecified mutation in the py domain(s) of this protein. region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P97764:p.Tyr162Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:13:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr162ala' Tue Jun 30 20:24:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr162Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association 4b nedd4-wbp2-1 2 4 unspecified role unspecified role bait bait purified purified ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P97765:p.Tyr200Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:08:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr200ala' Tue Jun 30 19:38:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr200Ala' ecoli Escherichia coli (strain K12) physical association physical association 4b nedd4-tmg2-1 2 6 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 4b nedd4-rnf11-1 2 5 unspecified role unspecified role prey prey cell lysate cell lysate region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:10:30 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py1 mutation' This is an unspecified mutation in the py domain(s) of this protein. region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 4b nedd4-litaf-1 2 3 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:11:41 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py1 mutation' This is an unspecified mutation in the py domain(s) of this protein. ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 4b nedd4-pmepa-1 2 4 unspecified role unspecified role bait bait purified purified ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9D7R2:p.Tyr139Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 14:52:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr139ala' Tue Jun 30 18:34:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr139Ala' tyr210ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:10:54 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py2 mutation' This is an unspecified mutation in the py domain(s) of this protein. c-terminal region sufficient to bind sufficient binding region sufficient to bind range range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 120 119 physical association physical association 4b nedd4-nfip1-1 2 4 unspecified role unspecified role bait bait purified purified ww domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:10:57 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py1 mutation' This is an unspecified mutation in the py domain(s) of this protein. ecoli Escherichia coli (strain K12) physical association physical association 4b bean1-nedd4 2 9 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9EQG5:p.Tyr144Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:29:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr144ala' Tue Jun 30 15:38:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr144Ala' Q9EQG5:p.Tyr165Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:27:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr165ala' Tue Jun 30 15:56:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr165Ala' Q9EQG5:p.[Tyr144Ala;Tyr165Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:09:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr144ala,tyr165ala' Tue Jun 30 17:59:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr144Ala;Tyr165Ala]' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey purified purified ww3 domain-containing region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range ww2 domain-containing region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3b nedd4-wbp2-2 2 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww1 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey cell lysate cell lysate region required to bind necessary binding region required to bind mutation analysis mutation analysis range range range range Wed Jul 06 17:44:08 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py2 mutation' This is an unspecified mutation in the py domain(s) of this protein. region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P97765:p.Tyr252Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:25:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr252ala' Tue Jun 30 17:30:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr252Ala' ecoli Escherichia coli (strain K12) physical association physical association 5a nedd4-prrg2 2 6 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww1 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 5a nedd4-rnf11-2 2 5 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9QYK7:p.Tyr40Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 20:12:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40ala' Tue Jun 30 17:15:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr40Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww1 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 5a nedd4-litaf-2 2 3 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9JLJ0:p.Tyr23Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:33:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr23ala' Tue Jun 30 17:08:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr23Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww1 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 5a nedd4-pmepa1 2 4 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww1 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9D7R2:p.Tyr139Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:56:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr139ala' Tue Jun 30 15:53:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr139Ala' c-terminal region sufficient to bind sufficient binding region sufficient to bind range range c-term range C-terminal range c-term range tyr210ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed Jul 06 17:43:31 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py2 mutation' This is an unspecified mutation in the py domain(s) of this protein. ecoli Escherichia coli (strain K12) physical association physical association 5a nedd4-ndfip1 2 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww1 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 5a nedd4-wbp1-2 2 8 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P97764:p.Tyr176Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 19:16:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr176ala' Tue Jun 30 16:32:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr176Ala' P97764:p.Tyr162Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:53:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr162ala' Tue Jun 30 16:51:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr162Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww2 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association 5b nedd4-wbp2-3 2 10 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tyr200ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed Jul 06 16:50:12 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py2 mutation' This is an unspecified mutation in the py domain(s) of this protein. ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww2 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association 5b nedd4-prrg2-1 2 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww2 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 5b nedd4-rnf11-3 2 5 unspecified role unspecified role prey prey cell lysate cell lysate Q9QYK7:p.Tyr40Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:50:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40ala' Tue Jun 30 15:35:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr40Ala' region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww2 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 5b nedd4-litaf-3 2 4 unspecified role unspecified role bait bait purified purified ww2 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9JLJ0:p.Tyr23Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 14:48:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr23ala' Tue Jun 30 18:10:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr23Ala' ecoli Escherichia coli (strain K12) physical association physical association 5b nedd4-pmepa1-1 2 7 unspecified role unspecified role prey prey cell lysate cell lysate Q9D7R2:p.Tyr210Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:49:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr210ala' Tue Jun 30 16:22:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr210Ala' region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal region sufficient to bind sufficient binding region sufficient to bind range range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww2 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 233 231 physical association physical association 5b nedd4-ndfip1-1 2 11 unspecified role unspecified role prey prey cell lysate cell lysate tyr42ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed Jul 06 16:49:33 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py1 mutation' This is an unspecified mutation in the py domain(s) of this protein. region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww2 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 5b nedd4-wbp2-4 2 10 unspecified role unspecified role prey prey cell lysate cell lysate P97765:p.Tyr200Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 19:47:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr200ala' Tue Jun 30 19:21:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr200Ala' region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww3 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 5c nedd4-prrg2-2 2 6 unspecified role unspecified role prey prey cell lysate cell lysate region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww3 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 5c nedd4-litaf-4 2 3 unspecified role unspecified role prey prey cell lysate cell lysate Q9JLJ0:p.Tyr23Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:43:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr23ala' Tue Jun 30 18:15:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr23Ala' region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww3 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 5c nedd4-pmepa1-2 2 7 unspecified role unspecified role prey prey cell lysate cell lysate c-terminal region sufficient to bind sufficient binding region sufficient to bind range range c-term range C-terminal range c-term range Q9D7R2:p.Tyr210Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Thu Apr 12 11:30:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr201ala' Wed May 02 16:48:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr210ala' Tue Jun 30 20:10:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr210Ala' region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww3 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association 5c nedd4-ndfip1-2 2 4 unspecified role unspecified role bait bait purified purified ww3 domain-containing region sufficient to bind sufficient binding region sufficient to bind range range range range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cell lysate cell lysate region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:49 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'py1 mutation' This is an unspecified mutation in the py domain(s) of this protein. region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 5c