UniProt UniProt http://www.uniprot.org The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. Exp. Cell Res. (0014-4827) 2000 mimix curation Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk 19-Jun-2012: Contacted by JYOTI. WI-38 human lung fibroblast cell line cDNA library yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk Accepted 2012-FEB-17 by MGT WI-38 human lung fibroblast cell line cDNA library Exp. Cell Res. (0014-4827) 2000 mimix curation The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. Exp. Cell Res. (0014-4827) 2000 mimix curation Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk 19-Jun-2012: Contacted by JYOTI. WI-38 human lung fibroblast cell line cDNA library crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. confocal microscopy confocal microscopy immunostaining immunostaining Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk Accepted 2012-FEB-17 by MGT 19-Jun-2012: Contacted by JYOTI. WI-38 human lung fibroblast cell line cDNA library Exp. Cell Res. (0014-4827) 2000 mimix curation The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. Exp. Cell Res. (0014-4827) 2000 mimix curation Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk 19-Jun-2012: Contacted by JYOTI. WI-38 human lung fibroblast cell line cDNA library human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk Accepted 2012-FEB-17 by MGT 19-Jun-2012: Contacted by JYOTI. WI-38 human lung fibroblast cell line cDNA library Exp. Cell Res. (0014-4827) 2000 mimix curation The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. Exp. Cell Res. (0014-4827) 2000 mimix curation Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk 19-Jun-2012: Contacted by JYOTI. WI-38 human lung fibroblast cell line cDNA library human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk Accepted 2012-FEB-17 by MGT 19-Jun-2012: Contacted by JYOTI. WI-38 human lung fibroblast cell line cDNA library Exp. Cell Res. (0014-4827) 2000 mimix curation The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. Exp. Cell Res. (0014-4827) 2000 mimix curation Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk 19-Jun-2012: Contacted by JYOTI. WI-38 human lung fibroblast cell line cDNA library yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk Accepted 2012-FEB-17 by MGT 19-Jun-2012: Contacted by JYOTI. WI-38 human lung fibroblast cell line cDNA library Exp. Cell Res. (0014-4827) 2000 mimix curation fbrl_human rRNA 2'-O-methyltransferase fibrillarin FBL FIB1 FLRN Histone-glutamine methyltransferase 34 kDa nucleolar scleroderma antigen U6 snRNA 2'-O-methyltransferase fibrillarin protein protein human Homo sapiens Human MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN DIP protein P22087 original sequence version: 84 DIP protein P22087 original sequence version: 154 2123F41E01EC557A ddx5_human Probable ATP-dependent RNA helicase DDX5 HLR1 DDX5 HELR G17P1 DEAD box protein 5 RNA helicase p68 protein protein human Homo sapiens Human MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ DIP protein P17844 original sequence version: 98 DIP protein P17844 original sequence version: 148 DIP protein P17844 original sequence version: 137 DIP protein P17844 original sequence version: 124 DIP protein P17844 original sequence version: 177 DIP protein P17844-1 original sequence version: 177 DIP protein P17844 original sequence version: 179 DIP protein P17844 original sequence version: 182 84DF684FD6871594 a0a3l7h5s4_crigr CgPICR_018616 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN similar to mouse Fbl UniProt entry AC P35550 F46EF70D194A8997 g3hct4_crigr DEAD box protein 5 Probable ATP-dependent RNA helicase DDX5 I79_008300 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MSSYSSDRDRGRDRGFGAPRFGGSRTGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVANMHNGMNQQAYAYPATAAAAPMIGYPMPTGYSQ 500EB551BA8F4F75 ddx5-fbl 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association no figure fbl-ddx5 3 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 1a ddx5-fbl-1 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 1b ddx5-fbl-2 4 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 2f fbl-ddx5-1 5 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 4a ddx5-fbl-3 5 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 4b ddx5-fbl-4 2 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 2f and 3m/y