UniProt UniProt http://www.uniprot.org Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. J. Biol. Chem. (0021-9258) 2000 imex curation Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl 15-Nov-2012: Contacted by pporras. human B cells Only protein-protein interactions human-skw6.4 Human B-lymphoblastoid EBV-transformed cell line skw6.4 Human B-lymphoblastoid EBV-transformed cell line confocal microscopy confocal microscopy immunostaining immunostaining Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. human B cells J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. J. Biol. Chem. (0021-9258) 2000 imex curation Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl 15-Nov-2012: Contacted by pporras. human B cells Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. human B cells J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. J. Biol. Chem. (0021-9258) 2000 imex curation Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl 15-Nov-2012: Contacted by pporras. human B cells Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. PKC kinase has been IPed from soluble and non-soluble fractioned cells and purified by washing. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. human B cells J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. J. Biol. Chem. (0021-9258) 2000 imex curation Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl 15-Nov-2012: Contacted by pporras. human B cells Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. human B cells J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. J. Biol. Chem. (0021-9258) 2000 imex curation Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl 15-Nov-2012: Contacted by pporras. human B cells Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. human B cells J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. J. Biol. Chem. (0021-9258) 2000 imex curation Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl 15-Nov-2012: Contacted by pporras. human B cells Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. human B cells J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32. J. Biol. Chem. (0021-9258) 2000 imex curation Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl 15-Nov-2012: Contacted by pporras. human B cells Only protein-protein interactions human-skw6.4 Human B-lymphoblastoid EBV-transformed cell line skw6.4 Human B-lymphoblastoid EBV-transformed cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Storz P., Hausser A., Link G., Dedio J., Ghebrehiwet B., Pfizenmaier K., Johannes F.J. Origin of PKCmu constructs according pmid 8601451. Exp. using GST-14-3-3 construct omitted as origin cannot be established. Exp. using PKCalpha/delta/zeta expressed in Sf158 cells (fig 3) omitted as origin of the PKC constructs cannot be established. In vitro kinase assays with aldolase as substrate omitted as its origin cannot be established. FJJ@IGB.Fhg.dl Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. human B cells J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation kpcd_human Protein kinase C delta type nPKC-delta PRKCD Tyrosine-protein kinase PRKCD PKCD protein protein human Homo sapiens Human MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED DIP protein Q05655 original sequence version: 92 DIP protein Q05655 original sequence version: 171 013F4314A2EE331A c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ DIP protein Q07021 original sequence version: 129 DIP protein Q07021 original sequence version: 156 2F747FA73BB1314B kpca_human Protein kinase C alpha type PRKCA PKCA PRKACA protein protein human Homo sapiens Human MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV 9EB157789A062349 kpcd1_human Serine/threonine-protein kinase D1 nPKC-D1 Protein kinase D Protein kinase C mu type nPKC-mu PRKD1 PKD PKD1 PRKCM protein protein human Homo sapiens Human MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSREPVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAASDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESFIGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDMEEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKSSTVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTSALIPNGANPHCFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHALMPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEETEMKALGERVSIL DIP protein Q15139 original sequence version: 79 DIP protein Q15139 original sequence version: 105 0BC9414C335D2DBB kpcz_human Protein kinase C zeta type PRKCZ PKC2 nPKC-zeta protein protein human Homo sapiens Human MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV 88CCD0577E6A596C prkd1-c1qbp-1 4 11 unspecified role unspecified role bait bait kinase domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey physical association physical association 1B c1qbp-prkd1 6 11 unspecified role unspecified role prey prey cell lysate cell lysate spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 9 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2A and 3 prkd1-c1qbp-2 6 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey cell lysate cell lysate human-skw6.4 Human B-lymphoblastoid EBV-transformed cell line skw6.4 Human B-lymphoblastoid EBV-transformed cell line physical association physical association 2B prkd1-c1qbp-3 7 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 2C and 7A c1qbp-prkd1-1 7 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 2C prkd1-c1qbp-4 2 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 3B prkca-c1qbp-2 2 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 3B prkcd-c1qbp-1 2 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 3B prkcz-c1qbp-4 2 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 3B c1qbp-prkd1-2 1 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 4 middle row prkd1-c1qbp-5 5 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 7A c1qbp-prkd1-3 3 11 putative self putative self unspecified role unspecified role purified purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation true 6b, 7 Autophosphorylation remained largely unaffected by the addition of p32 (Fig 6B) yet particulate fractions rich in p32 show reduced auto-phosphorylation. c1qbp-prkd1-4 3 11 putative self putative self unspecified role unspecified role purified purified human-skw6.4 Human B-lymphoblastoid EBV-transformed cell line skw6.4 Human B-lymphoblastoid EBV-transformed cell line phosphorylation phosphorylation reaction phosphorylation true 7 Particulate fractions rich in p32 show reduced auto-phosphorylation. c1qbp-prkd1-5 3 9 stimulator stimulator unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 putative self putative self unspecified role unspecified role purified purified spofr-158 Spodoptera frugiperda 158 cells 158 158 cells phosphorylation phosphorylation reaction phosphorylation 6a and c Phorbol ester activation (phosphatidylserine(PdBu micelles)