UniProt UniProt http://www.uniprot.org gC1q-R/p32, a C1q-binding protein, is a receptor for the InlB invasion protein of Listeria monocytogenes. gC1q-R/p32, a C1q-binding protein, is a receptor for the InlB invasion protein of Listeria monocytogenes. EMBO J. (0261-4189) 2000 imex curation Braun L., Ghebrehiwet B., Cossart P. pcossart@pasteur.fr 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Braun L., Ghebrehiwet B., Cossart P. pcossart@pasteur.fr Accepted 2012-NOV-02 by MGT 15-Nov-2012: Contacted by pporras. EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation gC1q-R/p32, a C1q-binding protein, is a receptor for the InlB invasion protein of Listeria monocytogenes. gC1q-R/p32, a C1q-binding protein, is a receptor for the InlB invasion protein of Listeria monocytogenes. EMBO J. (0261-4189) 2000 imex curation Braun L., Ghebrehiwet B., Cossart P. pcossart@pasteur.fr 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Braun L., Ghebrehiwet B., Cossart P. pcossart@pasteur.fr Accepted 2012-NOV-02 by MGT 15-Nov-2012: Contacted by pporras. EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation gC1q-R/p32, a C1q-binding protein, is a receptor for the InlB invasion protein of Listeria monocytogenes. gC1q-R/p32, a C1q-binding protein, is a receptor for the InlB invasion protein of Listeria monocytogenes. EMBO J. (0261-4189) 2000 imex curation Braun L., Ghebrehiwet B., Cossart P. pcossart@pasteur.fr 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom protein sequence protein sequence identification protein sequence Braun L., Ghebrehiwet B., Cossart P. pcossart@pasteur.fr Accepted 2012-NOV-02 by MGT 15-Nov-2012: Contacted by pporras. EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation gC1q-R/p32, a C1q-binding protein, is a receptor for the InlB invasion protein of Listeria monocytogenes. gC1q-R/p32, a C1q-binding protein, is a receptor for the InlB invasion protein of Listeria monocytogenes. EMBO J. (0261-4189) 2000 imex curation Braun L., Ghebrehiwet B., Cossart P. pcossart@pasteur.fr 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Braun L., Ghebrehiwet B., Cossart P. pcossart@pasteur.fr Accepted 2012-NOV-02 by MGT 15-Nov-2012: Contacted by pporras. EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation inlb_lismo Internalin B inlB Invasion protein InlB lmo0434 protein protein lismo Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) MKEKHNPRRKYCLISGLAIIFSLWIIIGNGAKVQAETITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNKPINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLKEVYTVSYDVDGTVIKTKVEAGTRITAPKPPTKQGYVFKGWYTEKNGGHEWNFNTDYMSGNDFTLYAVFKAETTEKAVNLTRYVKYIRGNAGIYKLPREDNSLKQGTLASHRCKALTVDREARNGGKLWYRLKNIGWTKAENLSLDRYDKMEYDKGVTAYARVRNASGNSVWTKPYNTAGAKHVNKLSVYQGKNMRILREAKTPITTWYQFSIGGKVIGWVDTRALNTFYKQSMEKPTRLTRYVSANKAGESYYKVPVADNPVKRGTLAKYKNQKLIVDCQATIEGQLWYRIRTSSTFIGWTKAANLRAQK CA05F31BEFE9748C gab1_chlae_protein Green monkey GAB1 protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey similar to human GAB1 UniProt AC Q13480 c1qbp_chlae Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP Globular head receptor of C1 complement protein Mitochondrial matrix protein p32 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MLPLLRCVPRVLGSAVPSLRAAAPASPFRQLLTPGPRLCARPFGLLSVRAGSERRPGLLRPRGPCACGCGCGLLHTEGDKAFVDFLNDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLMRKVAGEKITVTFNINNSIPPTFDGEEEPTQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSSGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYISFLEDLKSFVKSQ 67526590A80F5177 inlb-c1qbp-1 3 7 unspecified role unspecified role prey prey cell lysate cell lysate region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed 5 unspecified role unspecified role bait bait purified purified c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 3A inlb-c1qbp-2 1 5 unspecified role unspecified role bait bait purified purified c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey cell lysate cell lysate region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed physical association physical association 3C c1qbp-inlb-1 2 5 unspecified role unspecified role prey prey purified purified c-terminal his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 4 c1qbp-gab1 4 6 unspecified role unspecified role prey prey chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed 7 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 9 Listeria monocytogenes inlB (UniProt AC P25147)