UniProt UniProt http://www.uniprot.org Interaction of the alpha(1B)-adrenergic receptor with gC1q-R, a multifunctional protein. Interaction of the alpha(1B)-adrenergic receptor with gC1q-R, a multifunctional protein. J. Biol. Chem. (0021-9258) 1999 imex curation Xu Z., Hirasawa A., Shinoura H., Tsujimoto G. GFP was detected by tag fluorescence. gtsujimoto@nch.go.jp 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Xu Z., Hirasawa A., Shinoura H., Tsujimoto G. GFP was detected by tag fluorescence. gtsujimoto@nch.go.jp Accepted 2012-NOV-19 by MGT 18-Dec-2012: Contacted by IntAct-Help. rat liver cDNA J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation Interaction of the alpha(1B)-adrenergic receptor with gC1q-R, a multifunctional protein. Interaction of the alpha(1B)-adrenergic receptor with gC1q-R, a multifunctional protein. J. Biol. Chem. (0021-9258) 1999 imex curation Xu Z., Hirasawa A., Shinoura H., Tsujimoto G. GFP was detected by tag fluorescence. gtsujimoto@nch.go.jp 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Xu Z., Hirasawa A., Shinoura H., Tsujimoto G. GFP was detected by tag fluorescence. gtsujimoto@nch.go.jp Accepted 2012-NOV-19 by MGT 18-Dec-2012: Contacted by IntAct-Help. rat liver cDNA J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation Interaction of the alpha(1B)-adrenergic receptor with gC1q-R, a multifunctional protein. Interaction of the alpha(1B)-adrenergic receptor with gC1q-R, a multifunctional protein. J. Biol. Chem. (0021-9258) 1999 imex curation Xu Z., Hirasawa A., Shinoura H., Tsujimoto G. GFP was detected by tag fluorescence. gtsujimoto@nch.go.jp 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunostaining immunostaining Xu Z., Hirasawa A., Shinoura H., Tsujimoto G. GFP was detected by tag fluorescence. gtsujimoto@nch.go.jp Accepted 2012-NOV-19 by MGT 18-Dec-2012: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation Interaction of the alpha(1B)-adrenergic receptor with gC1q-R, a multifunctional protein. Interaction of the alpha(1B)-adrenergic receptor with gC1q-R, a multifunctional protein. J. Biol. Chem. (0021-9258) 1999 imex curation Xu Z., Hirasawa A., Shinoura H., Tsujimoto G. GFP was detected by tag fluorescence. gtsujimoto@nch.go.jp 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu Z., Hirasawa A., Shinoura H., Tsujimoto G. GFP was detected by tag fluorescence. gtsujimoto@nch.go.jp Accepted 2012-NOV-19 by MGT 18-Dec-2012: Contacted by IntAct-Help. rat liver cDNA J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation ada1b_mesau Alpha-1B adrenergic receptor ADRA1B Alpha-1B adrenoreceptor protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster MNPDLDTGHNTSAPAQWGELKDANFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRILGCQCRSGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGSQRTLPSASPSPGYLGRGAQPPLELCAYPEWKSGALLSLPEPPGRRGRLDSGPLFTFKLLGEPESPGTEGDASNGGCDATTDLANGQPGFKSNMPLAPGHF 6DAF1576D1C1CE2D c1qbp_rat Complement component 1 Q subcomponent-binding protein, mitochondrial Glycoprotein gC1qBP GC1q-R protein C1qbp Gc1qbp protein protein rat Rattus norvegicus (Rat) Rat MLPLLRCVPRALGAAATGLRASIPAPPLRHLLQPAPRPCLRPFGLLSVRAGSARRSGLLQPPVPCACGCGALHTEGDKAFVEFLTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKAEEQEPELTSTPNFVVEVTKTDGKKTLVLDCHYPEDEIGHEDEAESDIFSIKEVSFQTTGDSEWRDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ 54D238EFBCA6F41B adra1b-c1qbp-5 2 5 unspecified role unspecified role bait bait c_terminal_cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure adra1b-c1qbp-6 4 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 1 and 3 adra1b-c1qbp-7 1 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2 adra1b-c1qbp-9 3 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 4G adra1b-c1qbp-8 3 5 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 4M