MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification and characterization of the human HCG V gene product as a novel inhibitor of protein phosphatase-1. Identification and characterization of the human HCG V gene product as a novel inhibitor of protein phosphatase-1. Biochemistry (0006-2960) 1998 Zhang J., Zhang L., Zhao S., Lee EY. suggested by apalma in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Zhang J., Zhang L., Zhao S., Lee EY. suggested by apalma Biochemistry (0006-2960) 1998 Identification and characterization of the human HCG V gene product as a novel inhibitor of protein phosphatase-1. Identification and characterization of the human HCG V gene product as a novel inhibitor of protein phosphatase-1. Biochemistry (0006-2960) 1998 Zhang J., Zhang L., Zhao S., Lee EY. suggested by apalma in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Zhang J., Zhang L., Zhao S., Lee EY. suggested by apalma Biochemistry (0006-2960) 1998 pp1rb_human E3 ubiquitin-protein ligase PPP1R11 Protein phosphatase inhibitor 3 Hemochromatosis candidate gene V protein PPP1R11 HCGV TCTE5 Protein phosphatase 1 regulatory subunit 11 protein protein human Homo sapiens Human MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH D6788A5AAC073549 pp1a_rabit Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK 60C37E1AD9831DAC ppp1ca-ppp1r11 1 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component direct interaction direct interaction mint fig.3 ppp1ca-ppp1r11-1 2 3 inhibitor inhibitor neutral component neutral component 4 enzyme enzyme neutral component neutral component enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction mint fig.6