UniProt UniProt http://www.uniprot.org The Bmi-1 oncoprotein interacts with dinG and MPh2: the role of RING finger domains. The Bmi-1 oncoprotein interacts with dinG and MPh2: the role of RING finger domains. Oncogene (0950-9232) 1998 mimix curation Hemenway CS., Halligan BW., Levy LS. no e-mail adress orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hemenway CS., Halligan BW., Levy LS. no e-mail adress Accepted 2011-JUN-06 by ORCHARD Oncogene (0950-9232) 1998 orchard mimix curation The Bmi-1 oncoprotein interacts with dinG and MPh2: the role of RING finger domains. The Bmi-1 oncoprotein interacts with dinG and MPh2: the role of RING finger domains. Oncogene (0950-9232) 1998 mimix curation Hemenway CS., Halligan BW., Levy LS. no e-mail adress orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hemenway CS., Halligan BW., Levy LS. no e-mail adress Accepted 2011-JUN-06 by ORCHARD Oncogene (0950-9232) 1998 orchard mimix curation phc2_mouse Polyhomeotic-like protein 2 p36 Early development regulatory protein 2 Phc2 Edr2 Ph2 protein protein mouse Mus musculus Mouse MENELPVPHTSNRASVTTNTSGTNSSSGCISSSGGGGGSGGRPTAPQISVYSGIPDRQTVQVIQQALHRQPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVANRQGSTPGSSVSSQAPAQSSSLNLAASPAAAQLINRAQSVNSAAASGLAQQAVLLGNTSSPALTASQAQMYLRAQMLIFTPTATVATVQPELCTGSPARPPTPAQVQNLTLRTQQTPAAAASGPPPTQPVLPSLALKPTPSSSQPLPAPPQGRTMAQGSPAGAKPSGTDNAPETLKAGDGNCNMEGRPGPGRAVPAVATHPLIAPAYAHLQSHQLLPQPPAKHPQPQFVAQQQPQPPRPAPQVQSQPQLASVSPSLALQSSPEDHALPLGSVTQALPLQCSTTHVHKPGNSQQCHLPTLDTGSQNGHPEGGSHPPQRRFQHTSAVILQVQPASPVTPQQCAPDDWKEVVPAEKSVPVARPGPSPHQQAIIPAIPGGLPGPKSPNIQQCPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKPPQQDHTTTTDSEMEEPYLQESKEEGTPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGTTTHNRRRASKASLPTLTKDTKKQPSGTVPLSVTAALQLAHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLDLPDMHMRDLVGVGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS 87746AFD7808DC7B ring2_mouse E3 ubiquitin-protein ligase RING2 Rnf2 DinG Ring1b RING finger protein 2 RING finger protein 1B RING-type E3 ubiquitin transferase RING2 protein protein mouse Mus musculus Mouse MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK DIP protein Q9CQJ4 original sequence version: 124 DIP protein Q9CQJ4 original sequence version: 115 84BA5B3E044DB7EC bmi1_mouse Polycomb complex protein BMI-1 Bmi1 Pcgf4 Bmi-1 Polycomb group RING finger protein 4 protein protein mouse Mus musculus Mouse MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEEKRIITDDEIISLSIEFFDQSRLDRKVNKEKPKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKMSHQRDGLTNAGELESDSGSDKANSPAGGVPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSANHQSSFASRPRKSSLNGSSATSSG DIP protein P25916 original sequence version: 81 DIP protein P25916 original sequence version: 133 AD7DECDB6B29DCE5 bmi1-rnf2-1 2 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 1 rnf2-phc2-1 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association none rnf2-bmi1-1 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Figs. 1 and 3 bmi1-rnf2-3 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 2 rnf2-phc2-2 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 4 and table I Bmi1 (AC P25916) is enhancing the interaction bmi1-phc2-1 1 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 4 and Table I Rnf2 (AC Q9CQJ4) is enhancing the interaction