MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction of the ribosomal protein, L5, with protein phosphatase type 1. Interaction of the ribosomal protein, L5, with protein phosphatase type 1. J. Biol. Chem. (0021-9258) 1995 Hirano K., Ito M., Hartshorne DJ. suggested by santonico partial coverage rapid curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hirano K., Ito M., Hartshorne DJ. suggested by santonico J. Biol. Chem. (0021-9258) 1995 partial coverage rapid curation Interaction of the ribosomal protein, L5, with protein phosphatase type 1. Interaction of the ribosomal protein, L5, with protein phosphatase type 1. J. Biol. Chem. (0021-9258) 1995 Hirano K., Ito M., Hartshorne DJ. suggested by santonico partial coverage rapid curation in vitro In vitro cosedimentation cosedimentation predetermined predetermined participant predetermined Hirano K., Ito M., Hartshorne DJ. suggested by santonico J. Biol. Chem. (0021-9258) 1995 partial coverage rapid curation pp1b_rat Serine/threonine-protein phosphatase PP1-beta catalytic subunit Ppp1cb protein protein rat Rattus norvegicus (Rat) Rat MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR E8356022E9B94ECD rl5_rat 60S ribosomal protein L5 Rpl5 protein protein rat Rattus norvegicus (Rat) Rat MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVNGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVYEKKPKREVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES ABBB47AF1EBE4366 ppp1cb-rpl5 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association mint F1; F5 ppp1cb-rpl5-1 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association F1 mint