MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The Cutoff protein regulates piRNA cluster expression and piRNA production in the Drosophila germline. The Cutoff protein regulates piRNA cluster expression and piRNA production in the Drosophila germline. EMBO J. (0261-4189) 2011 imex curation Pane A., Jiang P., Zhao DY., Singh M., Schüpbach T. Only protein-protein interactions drome-ovary Drosophila melanogaster ovary ovary Ovary fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Pane A., Jiang P., Zhao DY., Singh M., Schüpbach T. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation The Cutoff protein regulates piRNA cluster expression and piRNA production in the Drosophila germline. The Cutoff protein regulates piRNA cluster expression and piRNA production in the Drosophila germline. EMBO J. (0261-4189) 2011 imex curation Pane A., Jiang P., Zhao DY., Singh M., Schüpbach T. Only protein-protein interactions drome-ovary Drosophila melanogaster ovary ovary Ovary anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Pane A., Jiang P., Zhao DY., Singh M., Schüpbach T. no EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation cuff_drome Protein cutoff CG13190 cuff protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSNYTILNIRAHSWAEKDNLVFPTITKPVSNGWFAWSPIGQFEPNSQKVPYVVVPPSIKFPISLRYKDSPPKLEKKPNIFLDNMLQYIESSSYMYVMVRNNQQAQLNANIVCTSEVLELMMCAPYEKKTGWSLGVTRYRNTMYICRIDVEQPDPIDQDNLKRAMQEFWLRNLRTHCVFENGIKMHQHNQSSEEHLRFHGVFSFDLNGNRVLFDSPVLAEMPSTTLNGSALSWVDLQIRPMFMSRLDWPEHNRTEALKWWVKCFLLGIESLYIARRDENAHVHNIEKTLVRDLWKSCEKDWSPTVCANFMIYLLNCISQVMAPIDCPSTVYLFQFDASQGTVSYKGLRGRNQYTFVSDWFRMMLDDHTNDMCKTPNLQTMSSIV 0FF9AC48BCCB1AEC hp1_drome Heterochromatin protein 1 Su(var)205 HP1 CG8409 Non-histone chromosomal protein C1A9 antigen protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEERLSWYSDNED DIP protein P05205 original sequence version: 93 DIP protein P05205 original sequence version: 157 DIP protein P05205 original sequence version: 117 6A5B204C487526B7 q7jxa8_drome rhi rhino hp1d Dmel\CG10683 HP1 HP1D HP1d RHI Rhi Rhino rno CG10683 Dmel_CG10683 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSRNHQRPNLGLVDAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKMNQKKGKNIKKTAGKIKDIENYPKTQMPSTSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLNLIEPTKDKDVGDTSLKTPPKSRRLIEFPQREDAPLSSKHVSPMLIRKESQPLQSSCTDDSDLGESSSSMSLPTVSSTSSEKSIKVTKSEPKTLGQIKFSSRSSDGGHAASSLGAPKEGDIGLDLSGSDSMDSEVESMRRCPRRKRKKTYPDWKFPEMTKPFGVNRGLDLDKILHCYQMNDDLFMFVTWKGCSSIDAVHINDIKEAYPLQIIKYFESLRIIVPK 8996711F329D4B45 cid_drome Histone H3-like centromeric protein cid cid CG13329 Centromere identifier protein CENP-A homolog CENP-A protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPRHSRAKRAPRPSANNSKSPNDDDTAFRSPEPEDGTDYGLEFTTSQLTLQDNNRRSSTLRRDAGRRQPAARDSSTSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMDREIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDRGRQF DIP protein Q9V6Q2 original sequence version: 106 DIP protein Q9V6Q2 original sequence version: 49 E125327C4EDD12D2 cuff-su_var_205 1 HP1 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Cuff 3 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization homomint mint f2 sf2 This analysis revealed that the Cuff protein is particularly enriched within and next to heterochromatic regions (Figure 2A A00 and B B00). Beginning in the late mitotic cyst and in all the following stages of egg chamber development, Cuff-positive foci extensively overlap with HP1. cid-cuff 1 CID 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Cuff 3 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization homomint mint f2 sf2 Interestingly, immunostainings with anti-CID antibodies in EGFP Cuff lines unveiled a significant accumulation of Cuff at centromeric/pericentromeric positions (Figure 2C C00). These results were confirmed by co-immunostaining experiments performed with anti-Cuff and anti-CID-specific antibodies in wild-type ovaries (Supplementary Figure S2B). cuff-rhi 1 Cuff 3 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rhi 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f6c mint Nuclear foci of Cuff/Rhino colocalization are clearly detectable in the late mitotic cysts, while they are less apparent during the first mitotic divisions of the cystoblasts. Cuff and Rhi strongly colocalize throughout oogenesis and in later egg chambers they are readily detectable in discrete nurse cell nuclear foci (Figure 6B B00 and C C00). cuff-rhi-1 2 Cuff 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rhi 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6d mint