MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural basis for cell surface patterning through NetrinG-NGL interactions. Structural basis for cell surface patterning through NetrinG-NGL interactions. EMBO J. (0261-4189) 2011 imex curation Seiradake E., Coles CH., Perestenko PV., Harlos K., McIlhinney RA., Aricescu AR., Jones EY. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Seiradake E., Coles CH., Perestenko PV., Harlos K., McIlhinney RA., Aricescu AR., Jones EY. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Structural basis for cell surface patterning through NetrinG-NGL interactions. Structural basis for cell surface patterning through NetrinG-NGL interactions. EMBO J. (0261-4189) 2011 imex curation Seiradake E., Coles CH., Perestenko PV., Harlos K., McIlhinney RA., Aricescu AR., Jones EY. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Seiradake E., Coles CH., Perestenko PV., Harlos K., McIlhinney RA., Aricescu AR., Jones EY. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Structural basis for cell surface patterning through NetrinG-NGL interactions. Structural basis for cell surface patterning through NetrinG-NGL interactions. EMBO J. (0261-4189) 2011 imex curation Seiradake E., Coles CH., Perestenko PV., Harlos K., McIlhinney RA., Aricescu AR., Jones EY. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Seiradake E., Coles CH., Perestenko PV., Harlos K., McIlhinney RA., Aricescu AR., Jones EY. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation ntng2_human Netrin-G2 Laminet-2 NTNG2 KIAA1857 LMNT2 UNQ9381/PRO34206 protein protein human Homo sapiens Human MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACATAGSFGNCECYGHSNRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDRCNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRGYTGVRCEQPRCDPADDDGGLDCDRAPGAAPRPATLLGCLLLLGLAARLGR B93A8A7E0E5A8CA3 lrrc4_human Leucine-rich repeat-containing protein 4 LRRC4 BAG NAG14 UNQ554/PRO1111 Netrin-G2 ligand Brain tumor-associated protein BAG Nasopharyngeal carcinoma-associated gene 14 protein protein protein human Homo sapiens Human MKLLWQVTVHHHTWNAILLPFVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI mint homomint 38159C81F6850E37 ntng1_human Netrin-G1 NTNG1 KIAA0976 LMNT1 Laminet-1 UNQ571/PRO1133 protein protein human Homo sapiens Human MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISSIGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIECYCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF mint homomint C51F872D7A2C60A6 lrc4c_human Leucine-rich repeat-containing protein 4C LRRC4C KIAA1580 NGL1 Netrin-G1 ligand UNQ292/PRO331 protein protein human Homo sapiens Human MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVVDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI 6058974872636838 lrrc4-ntng2 1 NGL2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NETRIN-G2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-7444373]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 767-767, sequence length 530 [EBI-7444373]423-767 direct interaction direct interaction homomint domino mint Coordinates and structure factors heve been deposited in the Protein Data Bank with accession code 3ZYI. t1 f2b f2c f2g f2h f2i lrrc4c-ntng1 1 NetrinG1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NGL1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint Coordinates and structure factors heve been deposited in the Protein Data Bank with accession code 3ZYJ. t1 f2a f2c f2d f2e f2f f3 lrrc4-ntng2-1 3 NGL2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NETRIN-G2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint sf5b lrrc4c-ntng1-1 3 NETRIN-G1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NGL1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint sf5b lrrc4-ntng2-2 2 NGL2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NETRIN-G2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint f4 sf6 ntng2-lrrc4 2 NGL2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9HBW1:p.Gly204Thr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G T Tue Jul 12 10:50:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:39:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly204thr' Tue Jun 30 15:54:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly204Thr' NETRIN-G2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q96CW9:p.Tyr75Thr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y T Tue Jul 12 10:09:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:42:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr75thr' Tue Jun 30 17:08:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr75Thr' Q96CW9:p.Pro74Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:09:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:52:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro74ala' Tue Jun 30 16:05:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro74Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint sf6 sf7 lrrc4c-ntng2 2 NETRIN-G2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NGL1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 43 45 direct interaction direct interaction homomint domino mint f4 sf6 ntng2-lrrc4c 2 NETRIN-G2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q96CW9:p.Tyr75Thr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y T Tue Jul 12 10:06:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:51:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr75thr' Tue Jun 30 15:53:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr75Thr' Q96CW9:p.Pro74Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:07:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:35:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro74ala' Tue Jun 30 19:28:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro74Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NGL1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q9HCJ2:p.Ala205Thr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A T Tue Jul 12 10:06:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:26:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala205thr' Tue Jun 30 16:19:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala205Thr' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 50 53 direct interaction direct interaction homomint domino mint sf6 sf7 lrrc4-ntng1 2 NGL2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NETRIN-G1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 58 56 direct interaction direct interaction homomint domino mint f4 sf6 lrrc4c-ntng1-2 2 NETRIN-G1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NGL1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 61 63 direct interaction direct interaction homomint domino mint f4 sf6 ntng1-lrrc4 2 NETRIN-G1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q9Y2I2:p.Pro85Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:05:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:38:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro85ala' Tue Jun 30 15:47:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro85Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9Y2I2:p.Tyr86Thr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y T Tue Jul 12 10:05:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:02:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr86thr' Tue Jun 30 16:18:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr86Thr' NGL2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q9HBW1:p.Gly204Thr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G T Tue Jul 12 10:05:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:33:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly204thr' Tue Jun 30 20:16:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly204Thr' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 71 67 direct interaction direct interaction homomint domino mint sf6 sf7 ntng1-lrrc4c 2 NETRIN-G1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q9Y2I2:p.Tyr86Thr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y T Tue Jul 12 10:24:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:04:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr86thr' Tue Jun 30 19:54:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr86Thr' Q9Y2I2:p.Pro85Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:24:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:43:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro85ala' Tue Jun 30 17:49:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro85Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NGL1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q9HCJ2:p.Ala205Thr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A T Tue Jul 12 10:24:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:30:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala205thr' Tue Jun 30 15:58:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala205Thr' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 76 79 direct interaction direct interaction homomint domino mint sf6 sf7