MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structure of the SSB-DNA polymerase III interface and its role in DNA replication. Structure of the SSB-DNA polymerase III interface and its role in DNA replication. EMBO J. (0261-4189) 2011 imex curation Marceau AH., Bahng S., Massoni SC., George NP., Sandler SJ., Marians KJ., Keck JL. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Marceau AH., Bahng S., Massoni SC., George NP., Sandler SJ., Marians KJ., Keck JL. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Structure of the SSB-DNA polymerase III interface and its role in DNA replication. Structure of the SSB-DNA polymerase III interface and its role in DNA replication. EMBO J. (0261-4189) 2011 imex curation Marceau AH., Bahng S., Massoni SC., George NP., Sandler SJ., Marians KJ., Keck JL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Marceau AH., Bahng S., Massoni SC., George NP., Sandler SJ., Marians KJ., Keck JL. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Structure of the SSB-DNA polymerase III interface and its role in DNA replication. Structure of the SSB-DNA polymerase III interface and its role in DNA replication. EMBO J. (0261-4189) 2011 imex curation Marceau AH., Bahng S., Massoni SC., George NP., Sandler SJ., Marians KJ., Keck JL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Marceau AH., Bahng S., Massoni SC., George NP., Sandler SJ., Marians KJ., Keck JL. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation ssb_ecoli Single-stranded DNA-binding protein Helix-destabilizing protein ssb exrB lexC b4059 JW4020 protein protein ecoli Escherichia coli (strain K12) MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF DIP protein P0AGE0 original sequence version: 44 F0AF43B6DC8D02FC holc_ecoli DNA polymerase III subunit chi holC b4259 JW4216 protein protein ecoli Escherichia coli (strain K12) MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK 7FEFFC359B28AA88 7FEFFC359B28AA88 ssb ssb peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) WDIPF mint 69D7605AB3100000 hold_ecoli DNA polymerase III subunit psi holD b4372 JW4334 protein protein ecoli Escherichia coli (strain K12) MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRALTVSPDQVLQLTPEKIAMLPQGSHCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAALWQQICTYEHDFFPRND DIP protein P28632 original sequence version: 88 DIP protein P28632 original sequence version: null 5B7356201E7E27FE holc-hold-1 3 SSB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified DNA pol III subunit psi 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified DNA pol III subunit chi 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association F1 T1 mint model coordinates and structure factors have been deposited in the Protein Data Bank (3SXU accession code). holc-hold-1 2 DNA pol III subunit chi 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P28905:p.Arg128Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:19:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:33:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg128ala' Tue Jun 30 18:53:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg128Ala' DNA pol III subunit psi 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified SSB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association F2 mint holc-hold-1 2 DNA pol III subunit psi 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified DNA pol III subunit chi 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P28905:p.Lys132Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:51:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:27:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys132ala' Tue Jun 30 19:55:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys132Ala' SSB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association F2 mint holc-hold-1 2 DNA pol III subunit chi 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P28905:p.Arg135Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:51:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:57:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg135ala' Tue Jun 30 17:10:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg135Ala' DNA pol III subunit psi 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified SSB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association F2 mint holc-hold-1 2 SSB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0AGE0:p.Pro177Ser mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P S Tue Jul 12 10:11:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:04:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro177ser' Tue Jun 30 16:15:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro177Ser' DNA pol III subunit psi 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified DNA pol III subunit chi 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association F2 mint In contrast, wt w/c binding to SSB113 (an SSB variant with the penultimate proline substituted for serine) was temperature dependent as observed previously (Yuzhakov et al, 1999) (Figure 2). holc-hold-1 1 SSB 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified DNA pol III subunit chi 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P28905:p.Arg128Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:11:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:18:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg128ala' Tue Jun 30 17:20:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg128Ala' DNA pol III subunit psi 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association SF1 mint