MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Pin1 and WWP2 regulate GluR2 Q/R site RNA editing by ADAR2 with opposing effects. Pin1 and WWP2 regulate GluR2 Q/R site RNA editing by ADAR2 with opposing effects. EMBO J. (0261-4189) 2011 imex curation Marcucci R., Brindle J., Paro S., Casadio A., Hempel S., Morrice N., Bisso A., Keegan LP., Del Sal G., O'Connell MA. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Marcucci R., Brindle J., Paro S., Casadio A., Hempel S., Morrice N., Bisso A., Keegan LP., Del Sal G., O'Connell MA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Pin1 and WWP2 regulate GluR2 Q/R site RNA editing by ADAR2 with opposing effects. Pin1 and WWP2 regulate GluR2 Q/R site RNA editing by ADAR2 with opposing effects. EMBO J. (0261-4189) 2011 imex curation Marcucci R., Brindle J., Paro S., Casadio A., Hempel S., Morrice N., Bisso A., Keegan LP., Del Sal G., O'Connell MA. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Marcucci R., Brindle J., Paro S., Casadio A., Hempel S., Morrice N., Bisso A., Keegan LP., Del Sal G., O'Connell MA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Pin1 and WWP2 regulate GluR2 Q/R site RNA editing by ADAR2 with opposing effects. Pin1 and WWP2 regulate GluR2 Q/R site RNA editing by ADAR2 with opposing effects. EMBO J. (0261-4189) 2011 imex curation Marcucci R., Brindle J., Paro S., Casadio A., Hempel S., Morrice N., Bisso A., Keegan LP., Del Sal G., O'Connell MA. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Marcucci R., Brindle J., Paro S., Casadio A., Hempel S., Morrice N., Bisso A., Keegan LP., Del Sal G., O'Connell MA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Pin1 and WWP2 regulate GluR2 Q/R site RNA editing by ADAR2 with opposing effects. Pin1 and WWP2 regulate GluR2 Q/R site RNA editing by ADAR2 with opposing effects. EMBO J. (0261-4189) 2011 imex curation Marcucci R., Brindle J., Paro S., Casadio A., Hempel S., Morrice N., Bisso A., Keegan LP., Del Sal G., O'Connell MA. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Marcucci R., Brindle J., Paro S., Casadio A., Hempel S., Morrice N., Bisso A., Keegan LP., Del Sal G., O'Connell MA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation wwp2_human NEDD4-like E3 ubiquitin-protein ligase WWP2 WW domain-containing protein 2 Atrophin-1-interacting protein 2 WWP2 HECT-type E3 ubiquitin transferase WWP2 protein protein human Homo sapiens Human MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIKENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFNRLDLPPYKSYEQLREKLLYAIEETEGFGQE FCCD75CBA61F2204 red1_human Double-stranded RNA-specific editase 1 ADARB1 ADAR2 DRADA2 RED1 RNA-editing deaminase 1 RNA-editing enzyme 1 dsRNA adenosine deaminase protein protein human Homo sapiens Human MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEGSRSYTQAGVQWCNHGSLQPRPPGLLSDPSTSTFQGAGTTEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP 02B583414DD59C20 pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE DIP protein Q13526 original sequence version: 65 DIP protein Q13526 original sequence version: 64 DIP protein Q13526 original sequence version: 163 DIP protein Q13526 original sequence version: 156 DIP protein Q13526 original sequence version: 117 35391AF40B7D1E13 adarb1-pin1 2 ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PIN1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1e homomint mint adarb1-pin1-1 2 PIN1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P78563:p.Ser31Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:11:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:24:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser31ala' Tue Jun 30 18:48:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser31Ala' P78563:p.Thr32Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:52:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:57:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr32ala' Tue Jun 30 19:07:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr32Ala' P78563:p.Ser26Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:12:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:27:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser26ala' Tue Jun 30 16:34:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser26Ala' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1e homomint mint adarb1-pin1-2 2 PIN1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P78563:p.Lys128Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:52:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:05:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys128ala' Tue Jun 30 17:08:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys128Ala' P78563:p.Lys281Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Tue Jul 12 10:52:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:13:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys281glu' Tue Jun 30 16:18:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys281Glu' P78563:p.Lys131Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:52:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:17:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys131ala' Tue Jun 30 18:35:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys131Ala' P78563:p.Lys282Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:12:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:16:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys282ala' Tue Jun 30 19:05:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys282Ala' P78563:p.Lys285Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:52:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:10:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys285ala' Tue Jun 30 16:53:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys285Ala' P78563:p.Lys127Glu mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Tue Jul 12 10:13:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:16:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys127glu' Tue Jun 30 17:37:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys127Glu' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1e homomint mint adarb1-pin1-3 2 PIN1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P78563:p.Lys128Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:14:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:56:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys128ala' Tue Jun 30 18:00:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys128Ala' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P78563:p.Lys131Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:14:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:17:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys131ala' Tue Jun 30 18:42:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys131Ala' P78563:p.Lys127Glu mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Tue Jul 12 10:14:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:14:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys127glu' Tue Jun 30 18:45:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys127Glu' P78563:p.Lys282Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:14:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:22:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys282ala' Tue Jun 30 18:13:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys282Ala' P78563:p.Lys285Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:14:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:54:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys285ala' Tue Jun 30 15:45:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys285Ala' P78563:p.Lys281Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Tue Jul 12 10:53:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:42:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys281glu' Tue Jun 30 16:06:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys281Glu' physical association physical association f1d homomint mint adarb1-pin1-4 2 ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P78563:p.Ser26Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:05:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:44:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser26ala' Tue Jun 30 18:25:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser26Ala' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P78563:p.Ser31Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:05:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:52:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser31ala' Tue Jun 30 20:25:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser31Ala' P78563:p.Thr32Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:05:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:56:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr32ala' Tue Jun 30 19:19:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr32Ala' PIN1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1d homomint mint adarb1-pin1-5 2 ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PIN1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1d homomint mint adarb1-wwp2 2 ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined WWP2 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6a homomint mint adarb1-wwp2-1 2 WWP2 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:47:10 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 4-72 flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6b homomint mint adarb1-wwp2-2 2 ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P78563:p.Pro189Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:49:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:01:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro189ala' Tue Jun 30 18:44:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro189Ala' P78563:p.Tyr191Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:07:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:31:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr191ala' Tue Jun 30 17:51:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr191Ala' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P78563:p.Pro188Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:07:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:17:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro188ala' Tue Jun 30 15:36:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro188Ala' WWP2 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6c homomint mint adarb1-wwp2-3 2 ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P78563:p.Tyr614Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:07:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:41:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr614ala' Tue Jun 30 18:11:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr614Ala' P78563:p.Pro611Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:07:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:11:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro611ala' Tue Jun 30 15:36:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro611Ala' P78563:p.Pro189Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:07:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:01:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro189ala' Tue Jun 30 16:09:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro189Ala' P78563:p.Pro612Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:07:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:13:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro612ala' Tue Jun 30 17:28:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro612Ala' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P78563:p.Pro188Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:07:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:44:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro188ala' Tue Jun 30 19:47:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro188Ala' P78563:p.Tyr191Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:50:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:47:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr191ala' Tue Jun 30 18:50:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr191Ala' WWP2 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6c homomint mint adarb1-wwp2-4 2 ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P78563:p.Pro611Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:21:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:20:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro611ala' Tue Jun 30 17:01:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro611Ala' P78563:p.Tyr614Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:57:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:27:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr614ala' Tue Jun 30 17:22:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr614Ala' P78563:p.Pro612Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:57:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:03:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro612ala' Tue Jun 30 16:43:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro612Ala' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined WWP2 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6c homomint mint pin1-adarb1 4 PIN1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P78563:p.Thr32Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:56:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:55:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr32ala' Tue Jun 30 16:17:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr32Ala' P78563:p.Ser31Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:20:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:15:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser31ala' Tue Jun 30 17:38:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser31Ala' P78563:p.Ser26Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:56:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:40:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser26ala' Tue Jun 30 16:26:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser26Ala' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1b homomint mint pin1-adarb1-1 4 ADAR2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PIN1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1b homomint mint adarb1-pin1-6 3 ADAR2 6 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PIN1 7 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13526:p.Ser67Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E Tue Jul 12 10:23:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:18:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser67glu' Tue Jun 30 17:47:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser67Glu' colocalization colocalization homomint mint f3b f3c adarb1-pin1-7 1 PIN1 7 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ADAR2 6 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell P78563:p.Pro33Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:22:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:47:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro33ala' Tue Jun 30 18:58:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro33Ala' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization homomint mint f4a f4b adarb1-pin1-8 1 ADAR2 6 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PIN1 7 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization sf4 homomint mint adarb1-pin1-9 1 ADAR2 6 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell P78563:p.Ser26Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:13:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:11:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser26ala' Tue Jun 30 19:44:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser26Ala' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P78563:p.Thr32Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:53:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:00:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr32ala' Tue Jun 30 18:46:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr32Ala' P78563:p.Ser31Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:14:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:19:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser31ala' Tue Jun 30 16:11:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser31Ala' PIN1 7 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization homomint sf3 mint