MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Probing the in vivo function of Mad1:C-Mad2 in the spindle assembly checkpoint. Probing the in vivo function of Mad1:C-Mad2 in the spindle assembly checkpoint. EMBO J. (0261-4189) 2011 imex curation Fava LL., Kaulich M., Nigg EA., Santamaria A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Fava LL., Kaulich M., Nigg EA., Santamaria A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Probing the in vivo function of Mad1:C-Mad2 in the spindle assembly checkpoint. Probing the in vivo function of Mad1:C-Mad2 in the spindle assembly checkpoint. EMBO J. (0261-4189) 2011 imex curation Fava LL., Kaulich M., Nigg EA., Santamaria A. Only protein-protein interactions human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Fava LL., Kaulich M., Nigg EA., Santamaria A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Probing the in vivo function of Mad1:C-Mad2 in the spindle assembly checkpoint. Probing the in vivo function of Mad1:C-Mad2 in the spindle assembly checkpoint. EMBO J. (0261-4189) 2011 imex curation Fava LL., Kaulich M., Nigg EA., Santamaria A. Only protein-protein interactions human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Fava LL., Kaulich M., Nigg EA., Santamaria A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND DIP protein Q13257 original sequence version: 133 DIP protein Q13257 original sequence version: 78 DIP protein Q13257 original sequence version: 105 DIP protein Q13257 original sequence version: 120 DIP protein Q13257 original sequence version: 127 DIP protein Q13257 original sequence version: 116 DIP protein Q13257 original sequence version: 150 DIP protein Q13257 original sequence version: 156 DIP protein Q13257 original sequence version: 134 B8DCBF0043836764 md2bp_human MAD2L1-binding protein Caught by MAD2 protein MAD2L1BP CMT2 KIAA0110 p31(comet) protein protein human Homo sapiens Human MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCCQFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLEDFFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE DIP protein Q15013 original sequence version: 90 5C49FBE1F456105C cdc27_human Cell division cycle protein 27 homolog CDC27 D0S1430E D17S978E CDC27 homolog H-NUC ANAPC3 Anaphase-promoting complex subunit 3 protein protein human Homo sapiens Human MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF DIP protein P30260 original sequence version: 141 DIP protein P30260 original sequence version: 111 DIP protein P30260 original sequence version: 117 DIP protein P30260 original sequence version: 135 DIP protein P30260 original sequence version: 148 DIP protein P30260 original sequence version: 153 DIP protein P30260 original sequence version: 157 DIP protein P30260 original sequence version: 162 DIP protein P30260 original sequence version: 171 DIP protein P30260 original sequence version: 118 E6C8F59C1EF1DCBA md1l1_human Mitotic spindle assembly checkpoint protein MAD1 Mitotic arrest deficient 1-like protein 1 Mitotic checkpoint MAD1 protein homolog Tax-binding protein 181 MAD1L1 MAD1 TXBP181 protein protein human Homo sapiens Human MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRSKSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQEELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQSFLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA DIP protein Q9Y6D9 original sequence version: 56 DIP protein Q9Y6D9 original sequence version: 99 DIP protein Q9Y6D9-1 original sequence version: 135 DIP protein Q9Y6D9 original sequence version: 135 DIP protein Q9Y6D9 original sequence version: 113 DA65529856A37EE3 bub1b_human Mitotic checkpoint serine/threonine-protein kinase BUB1 beta MAD3/BUB1-related protein kinase Mitotic checkpoint kinase MAD3L SSK1 BUB1B BUBR1 MAD3L Protein SSK1 protein protein human Homo sapiens Human MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAVLKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGKLTSPGALLFQ DIP protein O60566 original sequence version: 106 DIP protein O60566 original sequence version: 130 DIP protein O60566-1 original sequence version: 119 DIP protein O60566-1 original sequence version: 154 DIP protein O60566 original sequence version: 154 F7871103A56E6B46 cdc20_human Cell division cycle protein 20 homolog CDC20 p55CDC protein protein human Homo sapiens Human MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR DIP protein Q12834 original sequence version: 132 DIP protein Q12834 original sequence version: 74 DIP protein Q12834 original sequence version: 100 DIP protein Q12834 original sequence version: 118 DIP protein Q12834 original sequence version: 125 DIP protein Q12834 original sequence version: 114 DIP protein Q12834 original sequence version: 147 DIP protein Q12834 original sequence version: 162 FD5C967AF84089E8 mad2l1-cdc20 3 CDC20 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MAD2 4 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MAD1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association homomint mint f1b sf1d mad2l1-cdc20-1 3 p31-comet 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MAD2 4 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CDC20 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association homomint mint sf1d mad2l1-mad2l1bp 3 p31-comet 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MAD2 4 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1c homomint mint mad2l1-mad1l1 3 MAD1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified MAD2 4 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified physical association physical association f4e homomint mint mad2l1-cdc20-2 3 CDC20 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified MAD2 4 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified physical association physical association f4f homomint mint mad1l1-mad2l1-4 3 p31-comet 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MAD1 7 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MAD2 4 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association homomint sf5a mint mad2l1-bub1b 3 BUBR1 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified MAD2 4 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified MAD1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified CDC27 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified CDC20 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified association association homomint mint sf5d Three pools (APC/C+MCC, MCC and free-Mad2) of 5 fractions each were further analyzed by CM2276 IP mad2l1-mad2l1-1 1 MAD2 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13257:p.Leu13Gln mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:21:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 14:44:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu13gln' Tue Jun 30 17:42:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu13Gln' MAD2 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13257:p.Val193Asn mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V N Tue Jul 12 10:21:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 15:16:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val193asn' Tue Jun 30 17:09:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val193Asn' direct interaction direct interaction homomint mint sf1h mad1l1-mad2l1-5 2 MAD1 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell p31-comet 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Q15013:p.Phe191Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:23:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:39:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe191ala' Tue Jun 30 17:39:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe191Ala' Q15013:p.Gln83Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A Tue Jul 12 10:22:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:11:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln83ala' Tue Jun 30 18:28:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln83Ala' myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MAD2 4 polyclonal immunost polyclonal antibody immunostaining polyclonal immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f3b homomint mint To explore this point, we expressed Myc p31comet in its wild-type form or as a version carrying two point mutations (Q83A F191A, abbreviated as p31cometQAFA) that are known to abolish binding to C-Mad2 (Yang et al, 2007). Importantly, the use of a SV40 promoter allowed us to express p31comet at subendogenous levels (Figure 3A). Following cytosolic preextraction, Myc p31cometWT, but not Myc p31cometQAFA, was readily visualized at C-Mad2-positive KTs (Figure 3B). mad1l1-mad2l1-6 2 MAD1 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell MAD2 4 monoclonal immunost monoclonal antibody immunostaining monoclonal immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f3b homomint mint